Recopilación de las más interesantes imágenes educativas
TLD | com |
Datum vytvoření domény | 2014-10-09 |
Datum vypršení platnosti domény | 2023-10-09 |
Datum aktualizace domény | 2022-10-03 |
E-mail pro kontakt s administrátorem zneužití | [email protected] |
Telefon pro kontakt s administrátorem zneužití | +34.871-98-63-87 |
Míra odskoků | 59.02% |
Stránek na návštěvu | 2.45 |
Měsíční návštěvy | 1.83M |
Doba na stránce | 148.05S |
Alternativa |
|
Zobrazit záznamy v systému domén, včetně, ale neomezeně, záznamů A, CNAME, MX a TXT.
NS Záznam | IP |
---|---|
ns5.dondominio.com | |
ns2.dondominio.com |
Exchange | Priorita | IP |
---|---|---|
mail.imageneseducativas.com | 1 |
Odhalte nejlepší alternativy a konkurenty imageneseducativas.com v roce květen 2024 a analyzujte jejich výkon z hlediska návštěvnosti webu, hodnocení a afinit. 5 nejlepších alternativ imageneseducativas.com: actiludis.com, actividadesdeinfantilyprimaria.com, edufichas.com, escuelaenlanube.com, materialeducativo.org.
DOMÉNA | Afinita | Měsíční návštěvy | Kategorie | Celosvětové hodnocení | A | NS |
---|---|---|---|---|---|---|
100% | 2.02M | 33,026 |
| |||
90.8% | 1.25M | 40,473 |
| |||
89.7% | 130.94K | 379,118 |
| |||
87.5% | 577.45K | 108,729 |
| |||
86.8% | 424.40K | 119,825 |
| |||
78.1% | 288.69K | 150,988 |
| |||
76.8% | 492.04K | 116,786 |
| |||
76% | 942.92K | 60,101 |
| |||
74.4% | 531.02K | 99,106 |
| |||
73% | 289.77K | 157,731 |
|
CoHosted se odkazuje na situaci, kdy více doménových jmen (webových stránek) používá stejnou IP adresu pro své odpovídající webové servery. Mohou patřit různým osobám nebo organizacím a mohou sloužit zcela odlišným účelům. Domény hostované na stejné IP adrese jako imageneseducativas.com jsou: imageneseducativas.com.
Skupina Nameserverů se skládá z dvou nebo více nameserverů, často poskytovaných webovou hostingovou společností nebo registrátorem doménových jmen. Mít více nameserverů přidává redundanci a zlepšuje spolehlivost rozlišování DNS. Zde jsou domény používající následující nameserverů stejně jako imageneseducativas.com: ns2.dondominio.com, ns5.dondominio.com.
DOMÉNA | Celosvětové pořadí | Kategorie | Nadpis | A | MX |
---|---|---|---|---|---|
codere.pa | 45,796 | - | - | ||
actiludis.com | 147,048 | Actiludis - Material educativo accesible y gratuito | - | ||
conectabalear.com | 458,016 | ConectaBalear: Internet en Mallorca, Menorca, Ibiza y Formentera |
| ||
digitalavmagazine.com | 1,008,108 | Digital AV Magazine |
| ||
quimiziencia.es | 5,094,911 | Index | QuimiZiencia |
| ||
intelligenia.com | 5,668,292 | Počítače Elektronika A Technologie | Desarrollo a medida Web, APP e Intranet : Intelligenia |
| |
xponenzia.com | 5,903,032 | - | Xponenzia - Servicios y Soluciones Web | Desarrollo y diseño web en wordpress |
| |
angeltourenmallorca.de | 6,385,574 | - | Angeltouren Mallorca: Bootsausflüge zum angeln |
| |
mastermarketingupv.com | 6,535,128 | MACOM UPV: Máster en Dirección de Marketing y Comunicación |
| ||
lleialtat.cat | 8,071,102 | - | La Lleialtat Santsenca – Un espai de gestió comunitària del barri de Sants dedicat a la cultura, el veïnatge i la cooperació |
| |
bruixesdeburriac.com | 9,393,700 | - | - | - | |
codereonline.com | 9,411,778 | - | Investor Relations (CDRO) | Codere Online |
| |
cotoon.com | 9,565,417 | - | COTOON Alsace |
| |
patrimoniovirtual.com | 9,570,661 | - | Patrimonio Virtual - Universidad de Alicante |
| |
dominio.it | 12,036,830 | - | - |
| |
bullzone.es | 13,807,271 | - | ➤ Tienda Online de Nutrición y Accesorios K9 | Nº1 en España
– BULLZONE |
| |
magrican.com | 15,251,299 | - | MAGRICAN APEROS Y REPUESTOS S.L. -... | - | |
vitalcasa.com | 15,643,955 | - | Vitalcasa - Inmobiliaria en Denia. Venta de casas en Costa Blanca |
| |
nunuku.com | 18,550,363 | - | Almohada antiarrugas cervical Nest by Nunuku
– nunuku |
| |
teleline.es | 20,563,808 | - | teleline.es | Registrado en DonDominio |
| |
welele.es | - | - | Welele.es - Tu web de humor, memes, gifs y vídeos |
| |
sukhamindfulness.com | - | - | SUKHA MINDFULNESS |
| |
isglobal.org | - | - | - |
| |
shiftershh.com | - | - | SHH Shifter |
|
WHOIS je protokol pro dotazování a odpovědi používaný k získání informací o doménových jménech a IP adresách. Často se používá k získání registračních údajů a informací o vlastnictví pro konkrétní doménové jméno nebo IP adresu na internetu. Prozkoumejte nejdůležitější informace, včetně registračních údajů a informací o administrativním kontaktu pro imageneseducativas.com. To zahrnuje jméno vlastníka, organizaci, e-mailovou adresu pro zneužití, telefonní číslo pro zneužití a data vytvoření a vypršení platnosti.
Datum aktualizace domény | 2022-10-03 |
Datum vytvoření domény | 2014-10-09 |
Datum vypršení platnosti domény | 2023-10-09 |
Název domény | IMAGENESEDUCATIVAS.COM |
Registrar WHOIS server | whois.scip.es |
Stát/provincie registrovaného | Jaén |
Země registrovaného | ES |
E-mail registrovaného | Visit https://icann.online-validation.com/domain-contact/?domainname=imageneseducativas.com |
E-mail pro kontakt s administrátorem zneužití | [email protected] |
Telefon pro kontakt s administrátorem zneužití | +34.871-98-63-87 |
Domain Name: IMAGENESEDUCATIVAS.COM Registry Domain ID: 1879571074_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.scip.es Registrar URL: http://www.dondominio.com Updated Date: 2022-10-03T09:25:29Z Creation Date: 2014-10-09T09:38:07Z Registry Expiry Date: 2023-10-09T09:38:07Z Registrar: Soluciones Corporativas IP, SL Registrar IANA ID: 1383 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: 34871986387 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS2.DONDOMINIO.COM Name Server: NS5.DONDOMINIO.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2023-06-17T06:05:12Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.
Domain Name: IMAGENESEDUCATIVAS.COM Registry Domain ID: 1879571074_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.scip.es Registrar URL: https://www.dondominio.com Updated Date: 2022-10-03T11:25:29Z Creation Date: 2014-10-09T09:38:07Z Registrar Registration Expiration Date: 2023-10-09T09:38:07Z Registrar: DonDominio (SCIP) Registrar IANA ID: 1383 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +34.871-98-63-87 Reseller: Domain Status: ok http://www.icann.org/epp#ok Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Redacted for privacy Registrant Organization: Registrant Street: Redacted for privacy Registrant City: Redacted for privacy Registrant State/Province: Jaén Registrant Postal Code: Redacted for privacy Registrant Country: ES Registrant Phone: Redacted for privacy Registrant Phone Ext: Registrant Fax: Redacted for privacy Registrant Fax Ext: Registrant Email: Visit https://icann.online-validation.com/domain-contact/?domainname=imageneseducativas.com Registry Admin ID: Admin Name: Redacted for privacy Admin Organization: Redacted for privacy Admin Street: Redacted for privacy Admin City: Redacted for privacy Admin State/Province: Redacted for privacy Admin Postal Code: Redacted for privacy Admin Country: Redacted for privacy Admin Phone: Redacted for privacy Admin Phone Ext: Admin Fax: Redacted for privacy Admin Fax Ext: Admin Email: Visit https://icann.online-validation.com/domain-contact/?domainname=imageneseducativas.com Registry Tech ID: Tech Name: Redacted for privacy Tech Organization: Redacted for privacy Tech Street: Redacted for privacy Tech City: Redacted for privacy Tech State/Province: Redacted for privacy Tech Postal Code: Redacted for privacy Tech Country: Redacted for privacy Tech Phone: Redacted for privacy Tech Phone Ext: Tech Fax: Redacted for privacy Tech Fax Ext: Tech Email: Visit https://icann.online-validation.com/domain-contact/?domainname=imageneseducativas.com Name Server: NS5.DONDOMINIO.COM Name Server: NS2.DONDOMINIO.COM DNSSEC: Unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-17T08:05:00Z <<< For more information on Whois status codes, please visit https://icann.org/epp This WHOIS database is provided for information purposes only. We do not guarantee the accuracy of this data. The following uses of this system are expressly prohibited: (1) use of this system for unlawful purposes; (2) use of this system to collect information used in the mass transmission of unsolicited commercial messages in any medium; (3) use of high volume, automated, electronic processes against this database. By submitting this query, you agree to abide by this policy.
RDAP znamená Protokol pro přístup k registraci dat. Jedná se o protokol používaný pro přístup a získávání registrace dat pro internetové zdroje, jako jsou doménová jména, IP adresy a autonomní systémová čísla. RDAP má několik výhod oproti protokolu WHOIS, včetně podpory internacionalizace, zabezpečeného přístupu k datům a možnosti poskytovat diferencovaný přístup k registraci dat. Zde jsou surová data RDAP pro imageneseducativas.com.
Datum registrace | 2014-10-09 |
Datum vypršení platnosti | 2023-10-09 |
Datum poslední změny | 2022-10-03 |
Zneužití Tel. | 34871986387 |
Zneužití E-mail | [email protected] |
1{
2 "objectClassName": "domain",
3 "handle": "1879571074_DOMAIN_COM-VRSN",
4 "ldhName": "IMAGENESEDUCATIVAS.COM",
5 "links": [
6 {
7 "value": "https://rdap.verisign.com/com/v1/domain/IMAGENESEDUCATIVAS.COM",
8 "rel": "self",
9 "href": "https://rdap.verisign.com/com/v1/domain/IMAGENESEDUCATIVAS.COM",
10 "type": "application/rdap+json"
11 },
12 {
13 "value": "https://rdap.scip.es/domain/IMAGENESEDUCATIVAS.COM",
14 "rel": "related",
15 "href": "https://rdap.scip.es/domain/IMAGENESEDUCATIVAS.COM",
16 "type": "application/rdap+json"
17 }
18 ],
19 "status": [
20 "client transfer prohibited"
21 ],
22 "entities": [
23 {
24 "objectClassName": "entity",
25 "handle": "1383",
26 "roles": [
27 "registrar"
28 ],
29 "publicIds": [
30 {
31 "type": "IANA Registrar ID",
32 "identifier": "1383"
33 }
34 ],
35 "vcardArray": [
36 "vcard",
37 [
38 [
39 "version",
40 {},
41 "text",
42 "4.0"
43 ],
44 [
45 "fn",
46 {},
47 "text",
48 "Soluciones Corporativas IP, SL"
49 ]
50 ]
51 ],
52 "entities": [
53 {
54 "objectClassName": "entity",
55 "roles": [
56 "abuse"
57 ],
58 "vcardArray": [
59 "vcard",
60 [
61 [
62 "version",
63 {},
64 "text",
65 "4.0"
66 ],
67 [
68 "fn",
69 {},
70 "text",
71 ""
72 ],
73 [
74 "tel",
75 {
76 "type": "voice"
77 },
78 "uri",
79 "tel:34871986387"
80 ],
81 [
82 "email",
83 {},
84 "text",
85 "[email protected]"
86 ]
87 ]
88 ]
89 }
90 ]
91 }
92 ],
93 "events": [
94 {
95 "eventAction": "registration",
96 "eventDate": "2014-10-09T09:38:07Z"
97 },
98 {
99 "eventAction": "expiration",
100 "eventDate": "2023-10-09T09:38:07Z"
101 },
102 {
103 "eventAction": "last changed",
104 "eventDate": "2022-10-03T09:25:29Z"
105 },
106 {
107 "eventAction": "last update of RDAP database",
108 "eventDate": "2023-06-17T05:53:23Z"
109 }
110 ],
111 "secureDNS": {
112 "delegationSigned": false
113 },
114 "nameservers": [
115 {
116 "objectClassName": "nameserver",
117 "ldhName": "NS2.DONDOMINIO.COM"
118 },
119 {
120 "objectClassName": "nameserver",
121 "ldhName": "NS5.DONDOMINIO.COM"
122 }
123 ],
124 "rdapConformance": [
125 "rdap_level_0",
126 "icann_rdap_technical_implementation_guide_0",
127 "icann_rdap_response_profile_0"
128 ],
129 "notices": [
130 {
131 "title": "Terms of Use",
132 "description": [
133 "Service subject to Terms of Use."
134 ],
135 "links": [
136 {
137 "href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
138 "type": "text/html"
139 }
140 ]
141 },
142 {
143 "title": "Status Codes",
144 "description": [
145 "For more information on domain status codes, please visit https://icann.org/epp"
146 ],
147 "links": [
148 {
149 "href": "https://icann.org/epp",
150 "type": "text/html"
151 }
152 ]
153 },
154 {
155 "title": "RDDS Inaccuracy Complaint Form",
156 "description": [
157 "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
158 ],
159 "links": [
160 {
161 "href": "https://icann.org/wicf",
162 "type": "text/html"
163 }
164 ]
165 }
166 ]
167}
Zadejte IP adresu pro získání podrobných informací o ní, včetně geografického umístění, poskytovatele, ASN a informací z Whois. Sledujte a lokalizujte IP adresy.
Na 1 IP adrese/ích je hostován imageneseducativas.com. 149.202.81.10
Doména imageneseducativas.com byla zaregistrována 2014-10-09.
Platnost domény imageneseducativas.com vyprší 2023-10-09.
Sociální média