Domæneoplysninger

newamsterdamtheatretickets.info

newamsterdamtheatretickets.info
TLDinfo
Domæne oprettet dato2018-06-25
Domæne udløbsdato2024-06-25
Domæne opdateret dato2023-05-17
Registrator misbrugskontakt e-mail[email protected]
Registrator misbrugskontakt telefon+1.4806242505
DNSCO-HostedNS-GruppeWHOISRDAP

DNS

Vis domænesystemoptegnelser, herunder, men ikke begrænset til, A-, CNAME-, MX- og TXT-optegnelser.

A

En A-optegnelse (Adress-optegnelse) er en type DNS (Domain Name System) optegnelse, der kortlægger et domænenavn til en IPv4 (Internet Protocol version 4) adresse.

NS

En NS-optegnelse (Navneserver-optegnelse) er en type DNS (Domain Name System) optegnelse, der angiver, hvilke navneservere der er autoritative for et bestemt domæne.
NS OptegnelseIP
janet.ns.cloudflare.com
mark.ns.cloudflare.com

TXT

En TXT-optegnelse (Tekst-optegnelse) er en type DNS (Domain Name System) optegnelse, der giver dig mulighed for at tilknytte vilkårlig tekstinformation til et domænenavn.
  • google-site-verification=640BHkbbOnLsoRoVydKEYceMVNfjjNwg6Dh7AQ9-A38

CO-Hosted

CoHosted refererer til en situation, hvor flere domænenavne (websteder) bruger den samme IP-adresse til at pege på deres respektive webservere. De kan tilhøre forskellige personer eller organisationer og kan tjene helt forskellige formål. Domænerne, der er hostet på samme IP-adresse som newamsterdamtheatretickets.info, er newamsterdamtheatretickets.info.

NS-Gruppe

En Nameserver-gruppe består af to eller flere navneservere, ofte leveret af webhosting-selskabet eller domæneregistranten. At have flere navneservere tilføjer redundans og forbedrer pålideligheden af DNS-opløsning. Her er domænerne, der bruger følgende navneservere, de samme som newamsterdamtheatretickets.info: janet.ns.cloudflare.com, mark.ns.cloudflare.com.

DOMÆNE
Global rangering
KategoriTitelAMX
hajfon.top
551,475
-
-
  • mail.hajfon.top
spacefox.shop
673,719
BRACELETS METEORITE & OBJETS DE L'ESPACE | SPACEFOX
  • mx0.mail.ovh.net
  • mx1.mail.ovh.net
  • mx2.mail.ovh.net
nimzero.site
-
-
-
--
recipekit.app
-
-
-
  • in2-smtp.messagingengine.com
  • in1-smtp.messagingengine.com
wintrustarenatickets.info
-
-
-
-
bernardbjacobstheatertickets.info
-
-
-
-
waltdisneyconcerthalltickets.info
-
-
-
-
stjamestheatretickets.info
-
-
-
-
playstationtheatertickets.info
-
-
-
-
johngoldentheatretickets.info
-
-
-
-
marquistheatrenytickets.info
-
-
-
-
lyrictheatrenewyorktickets.info
-
-
-
-
utcmckenziearenatickets.info
-
-
-
-
whiteriveramphitheatretickets.info
-
-
-
-
showarecentertickets.info
-
-
-
-
barrymoretheatrenytickets.info
-
-
-
-
lyceumtheatrenewyorktickets.info
-
-
-
-
thenovotickets.info
-
-
-
-
comericaparktickets.info
-
-
-
-
louisvillepalacetickets.info
-
-
-
-
nationaltheatredctickets.info
-
-
-
-
shrineexpohalltickets.info
-
-
-
-
ahmansontheatretickets.info
-
-
-
-
fordstheatretickets.info
-
-
-
-

WHOIS

WHOIS er en forespørgsel- og svarprotokol, der bruges til at få oplysninger om domænenavne og IP-adresser. Det bruges ofte til at hente registreringsoplysninger og ejeroplysninger for et specifikt domænenavn eller en IP-adresse på internettet. Udforsk de vigtigste oplysninger, herunder registreringsoplysninger og administrative kontaktoplysninger for newamsterdamtheatretickets.info. Dette inkluderer ejerens navn, organisation, e-mailadresse til misbrug, telefonnummer til misbrug samt oprettelses- og udløbsdatoer.

Resumé

Domæne opdateret dato2023-05-17
Domæne oprettet dato2018-06-25
Domæne udløbsdato2024-06-25
Domænenavnnewamsterdamtheatretickets.info
Registrator WHOIS-serverwhois.godaddy.com/
Registrants organisationDomains By Proxy, LLC
Registrants stat/provinsArizona
Registrants landUS
Registrants e-mailPlease query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrator misbrugskontakt e-mail[email protected]
Registrator misbrugskontakt telefon+1.4806242505

Rådata

whois.nic.info

Domain Name: newamsterdamtheatretickets.info Registry Domain ID: 6bdbfa4e29594b519258d805779149a8-DONUTS Registrar WHOIS Server: whois.godaddy.com/ Registrar URL: http://www.godaddy.com/domains/search.aspx?ci=8990 Updated Date: 2023-05-17T13:48:26Z Creation Date: 2018-06-25T16:22:11Z Registry Expiry Date: 2024-06-25T16:22:11Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: Domains By Proxy, LLC Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: Arizona Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: US Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Name Server: mark.ns.cloudflare.com Name Server: janet.ns.cloudflare.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-06-29T19:42:08Z <<< For more information on Whois status codes, please visit https://icann.org/epp Terms of Use: Access to WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the registry database. The data in this record is provided by Identity Digital or the Registry Operator for informational purposes only, and accuracy is not guaranteed. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Identity Digital except as reasonably necessary to register domain names or modify existing registrations. When using the Whois service, please consider the following: The Whois service is not a replacement for standard EPP commands to the SRS service. Whois is not considered authoritative for registered domain objects. The Whois service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the Whois services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of Whois service access. Abuse of the Whois system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the Whois records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data provided by Identity Digital can be requested by submitting a request via the form found at https://www.identity.digital/about/policies/whois-layered-access/. The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Identity Digital Inc. and Registry Operator reserve the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

whois.godaddy.com

Rate limit exceeded. Try again after: 19s

RDAP

RDAP står for Registreringsdata Adgangsprotokol. Det er en protokol, der bruges til at få adgang til og hente registreringsdata for internetressourcer som domænenavne, IP-adresser og autonome systemnumre. RDAP har flere fordele i forhold til WHOIS-protokollen, herunder understøttelse af internationalisering, sikker adgang til data og evnen til at levere differentieret adgang til registreringsdata. Her er de rå RDAP-data for newamsterdamtheatretickets.info.

Resumé

Registreringsdato2018-06-25
Udløbsdato2024-06-25
Seneste ændringsdato2023-05-17
Misbrug Telefon+1.4806242505
Misbrug E-mail[email protected]

Rådata

1{
2        "rdapConformance": [
3                "rdap_level_0",
4                "icann_rdap_response_profile_0",
5                "icann_rdap_technical_implementation_guide_0"
6        ],
7        "notices": [
8                {
9                        "title": "Terms of Service",
10                        "description": [
11                                "Identity Digital Inc. provides this RDAP service for informational purposes only, and to assist persons in obtaining information about or related to a domain name registration record. Identity Digital does not guarantee its accuracy. Users accessing the Identity Digital RDAP service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Identity Digital or any ICANN-accredited registrar, except as reasonably necessary to register domain names or modify existing registrations. When using the Identity Digital RDAP service, please consider the following: the RDAP service is not a replacement for standard EPP commands to the SRS service. RDAP is not considered authoritative for registered domain objects. The RDAP service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the RDAP services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of RDAP service access. Abuse of the RDAP system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the RDAP records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data can be requested by submitting a request via the form found at https://www.identity.digital/about/policies/RDAP-layered-access/ Identity Digital Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy."
12                        ],
13                        "links": [
14                                {
15                                        "value": "https://rdap.donuts.co/rdap/domain/newamsterdamtheatretickets.info",
16                                        "rel": "alternate",
17                                        "href": "https://www.identity.digital/about/policies/rdap-access-policy/",
18                                        "type": "text/html"
19                                }
20                        ]
21                },
22                {
23                        "title": "Status Codes",
24                        "description": [
25                                "For more information on domain status codes, please visit https://icann.org/epp"
26                        ],
27                        "links": [
28                                {
29                                        "value": "https://icann.org/epp",
30                                        "rel": "self",
31                                        "href": "https://icann.org/epp",
32                                        "type": "application/rdap+json"
33                                }
34                        ]
35                },
36                {
37                        "title": "RDDS Inaccuracy Complaint Form",
38                        "description": [
39                                "URL of the ICANN RDDS Inaccuracy Complaint Form: https://www.icann.org/wicf"
40                        ],
41                        "links": [
42                                {
43                                        "value": "https://www.icann.org/wicf",
44                                        "rel": "self",
45                                        "href": "https://www.icann.org/wicf",
46                                        "type": "application/rdap+json"
47                                }
48                        ]
49                }
50        ],
51        "ldhName": "newamsterdamtheatretickets.info",
52        "unicodeName": "newamsterdamtheatretickets.info",
53        "nameservers": [
54                {
55                        "ldhName": "mark.ns.cloudflare.com",
56                        "unicodeName": "mark.ns.cloudflare.com",
57                        "objectClassName": "nameserver",
58                        "handle": "205702ecc79a41e899ae7ef1673916eb-DONUTS",
59                        "status": [
60                                "associated"
61                        ]
62                },
63                {
64                        "ldhName": "janet.ns.cloudflare.com",
65                        "unicodeName": "janet.ns.cloudflare.com",
66                        "objectClassName": "nameserver",
67                        "handle": "4d14cf3156804d7ea92bf055f0dc5c16-DONUTS",
68                        "status": [
69                                "associated"
70                        ]
71                }
72        ],
73        "publicIds": [
74                {
75                        "type": "IANA Registrar ID",
76                        "identifier": "146"
77                }
78        ],
79        "objectClassName": "domain",
80        "handle": "6bdbfa4e29594b519258d805779149a8-DONUTS",
81        "status": [
82                "client delete prohibited",
83                "client renew prohibited",
84                "client transfer prohibited",
85                "client update prohibited"
86        ],
87        "events": [
88                {
89                        "eventAction": "expiration",
90                        "eventDate": "2024-06-25T16:22:11.479Z"
91                },
92                {
93                        "eventAction": "registration",
94                        "eventDate": "2018-06-25T16:22:11.479Z"
95                },
96                {
97                        "eventAction": "last changed",
98                        "eventDate": "2023-05-17T13:48:26.493Z"
99                },
100                {
101                        "eventAction": "last update of RDAP database",
102                        "eventDate": "2023-06-29T09:29:53.54Z"
103                }
104        ],
105        "entities": [
106                {
107                        "vcardArray": [
108                                "vcard",
109                                [
110                                        [
111                                                "version",
112                                                {},
113                                                "text",
114                                                "4.0"
115                                        ],
116                                        [
117                                                "org",
118                                                {
119                                                        "type": "work"
120                                                },
121                                                "text",
122                                                "Domains By Proxy, LLC"
123                                        ],
124                                        [
125                                                "adr",
126                                                {},
127                                                "text",
128                                                [
129                                                        "",
130                                                        "",
131                                                        "",
132                                                        "",
133                                                        "Arizona",
134                                                        "",
135                                                        "US"
136                                                ]
137                                        ]
138                                ]
139                        ],
140                        "roles": [
141                                "registrant"
142                        ],
143                        "objectClassName": "entity",
144                        "remarks": [
145                                {
146                                        "title": "REDACTED FOR PRIVACY",
147                                        "type": "object redacted due to authorization",
148                                        "description": [
149                                                "Some of the data in this object has been removed."
150                                        ]
151                                },
152                                {
153                                        "title": "EMAIL REDACTED FOR PRIVACY",
154                                        "type": "object redacted due to authorization",
155                                        "description": [
156                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
157                                        ]
158                                }
159                        ],
160                        "events": [
161                                {
162                                        "eventAction": "last update of RDAP database",
163                                        "eventDate": "2023-06-29T09:29:53.54Z"
164                                }
165                        ]
166                },
167                {
168                        "vcardArray": [
169                                "vcard",
170                                [
171                                        [
172                                                "version",
173                                                {},
174                                                "text",
175                                                "4.0"
176                                        ]
177                                ]
178                        ],
179                        "roles": [
180                                "technical"
181                        ],
182                        "objectClassName": "entity",
183                        "remarks": [
184                                {
185                                        "title": "REDACTED FOR PRIVACY",
186                                        "type": "object redacted due to authorization",
187                                        "description": [
188                                                "Some of the data in this object has been removed."
189                                        ]
190                                },
191                                {
192                                        "title": "EMAIL REDACTED FOR PRIVACY",
193                                        "type": "object redacted due to authorization",
194                                        "description": [
195                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
196                                        ]
197                                }
198                        ],
199                        "events": [
200                                {
201                                        "eventAction": "last update of RDAP database",
202                                        "eventDate": "2023-06-29T09:29:53.54Z"
203                                }
204                        ]
205                },
206                {
207                        "vcardArray": [
208                                "vcard",
209                                [
210                                        [
211                                                "version",
212                                                {},
213                                                "text",
214                                                "4.0"
215                                        ]
216                                ]
217                        ],
218                        "roles": [
219                                "administrative"
220                        ],
221                        "objectClassName": "entity",
222                        "remarks": [
223                                {
224                                        "title": "REDACTED FOR PRIVACY",
225                                        "type": "object redacted due to authorization",
226                                        "description": [
227                                                "Some of the data in this object has been removed."
228                                        ]
229                                },
230                                {
231                                        "title": "EMAIL REDACTED FOR PRIVACY",
232                                        "type": "object redacted due to authorization",
233                                        "description": [
234                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
235                                        ]
236                                }
237                        ],
238                        "events": [
239                                {
240                                        "eventAction": "last update of RDAP database",
241                                        "eventDate": "2023-06-29T09:29:53.54Z"
242                                }
243                        ]
244                },
245                {
246                        "vcardArray": [
247                                "vcard",
248                                [
249                                        [
250                                                "version",
251                                                {},
252                                                "text",
253                                                "4.0"
254                                        ],
255                                        [
256                                                "fn",
257                                                {},
258                                                "text",
259                                                "GoDaddy.com, LLC"
260                                        ]
261                                ]
262                        ],
263                        "roles": [
264                                "registrar"
265                        ],
266                        "publicIds": [
267                                {
268                                        "type": "IANA Registrar ID",
269                                        "identifier": "146"
270                                }
271                        ],
272                        "objectClassName": "entity",
273                        "handle": "146",
274                        "entities": [
275                                {
276                                        "vcardArray": [
277                                                "vcard",
278                                                [
279                                                        [
280                                                                "version",
281                                                                {},
282                                                                "text",
283                                                                "4.0"
284                                                        ],
285                                                        [
286                                                                "tel",
287                                                                {
288                                                                        "type": "voice"
289                                                                },
290                                                                "uri",
291                                                                "tel:+1.4806242505"
292                                                        ],
293                                                        [
294                                                                "email",
295                                                                {},
296                                                                "text",
297                                                                "[email protected]"
298                                                        ]
299                                                ]
300                                        ],
301                                        "roles": [
302                                                "abuse"
303                                        ],
304                                        "objectClassName": "entity",
305                                        "handle": "b807ff1126cc4ed5a87c6225de1cc279-DONUTS"
306                                }
307                        ],
308                        "links": [
309                                {
310                                        "value": "https://rdap.donuts.co/rdap/entity/146",
311                                        "rel": "self",
312                                        "href": "https://rdap.donuts.co/rdap/entity/146",
313                                        "type": "application/rdap+json"
314                                }
315                        ]
316                }
317        ],
318        "links": [
319                {
320                        "value": "https://rdap.godaddy.com/v1/domain/newamsterdamtheatretickets.info",
321                        "rel": "related",
322                        "href": "https://rdap.godaddy.com/v1/domain/newamsterdamtheatretickets.info",
323                        "type": "application/rdap+json"
324                },
325                {
326                        "value": "https://rdap.donuts.co/rdap/domain/newamsterdamtheatretickets.info",
327                        "rel": "self",
328                        "href": "https://rdap.donuts.co/rdap/domain/newamsterdamtheatretickets.info",
329                        "type": "application/rdap+json"
330                }
331        ]
332}

Gratis Værktøjer

IP-Adresseopslag

Indtast en IP-adresse for at få detaljerede oplysninger om den, herunder geografisk placering, udbyder, ASN og Whois-information. Spor og lokaliser IP-adresser.

Hjemmeside Alternativfinder

Undersøg hjemmesider og få en række alternative muligheder.

Hvad er Min IP

Alle oplysninger om din IP-adresse. Placering, tidszone, netværk, adressetype (IPv4 eller IPv6) og mere. Se din rigtige offentlige IP-adresse.

FAQ

På hvilke IP-adresser er newamsterdamtheatretickets.info hostet?

Der er 2 IP-adresser, der hoster newamsterdamtheatretickets.info. 172.67.201.231, 104.21.85.39

Hvornår udløber newamsterdamtheatretickets.info?

newamsterdamtheatretickets.info udløber 2024-06-25.

Hvornår blev newamsterdamtheatretickets.info registreret?

newamsterdamtheatretickets.info blev registreret 2018-06-25.