Detalles del dominio

flash-poker.info

flash-poker.info-logoTop Of The World - Just another WordPress site

Just another WordPress site

TLDinfo
Fecha de creación del dominio2022-09-28
Fecha de vencimiento del dominio2023-09-28
Fecha de actualización del dominio2022-11-23
Correo electrónico de contacto para abuso al registrador[email protected]
Teléfono de contacto para abuso al registrador+1.8779770099
ALTERNATIVO
  • https://flash-poker.info/feed/
  • https://flash-poker.info/comments/feed/
DNSCO-HostedGrupo de NSWHOISRDAP

DNS

Ver registros del sistema de dominio, incluidos, entre otros, los registros A, CNAME, MX y TXT.

A

Un registro A (registro de dirección) es un tipo de registro DNS (Sistema de Nombres de Dominio) que asigna un nombre de dominio a una dirección IPv4 (Protocolo de Internet versión 4).

NS

Un registro NS (registro de servidor de nombres) es un tipo de registro DNS (Sistema de Nombres de Dominio) que especifica qué servidores de nombres son autoritativos para un dominio específico.
Registro NSIP
dilbert.ns.cloudflare.com
zara.ns.cloudflare.com

CO-Hosted

CoHosted se refiere a una situación en la que varios nombres de dominio (sitios web) utilizan la misma dirección IP para apuntar a sus respectivos servidores web. Pueden pertenecer a diferentes personas u organizaciones y pueden servir propósitos completamente diferentes. Los dominios alojados en la misma dirección IP que flash-poker.info son: flash-poker.info.

Grupo de NS

Un grupo de servidores de nombres consta de dos o más servidores de nombres, generalmente proporcionados por la empresa de alojamiento web o el registrador de dominios. Tener varios servidores de nombres agrega redundancia y mejora la confiabilidad de la resolución de DNS. Aquí están los dominios que utilizan los siguientes servidores de nombres, los mismos que flash-poker.info: dilbert.ns.cloudflare.com, zara.ns.cloudflare.com.

DOMINIO
Clasificación global
CategoríaTítuloAMX
mixrootmod.com
25,533
-
Mixrootmods - Managment study material
  • mx2.hostinger.in
  • mx1.hostinger.in
amrod.ng
2,178,223
-
Corporate Gifts | Clothing | Promotional Items Trade Only Supplier
  • za-smtp-inbound-1.mimecast.co.za
  • za-smtp-inbound-2.mimecast.co.za
amrod.co.bw
-
-
Corporate Gifts | Clothing | Promotional Items Trade Only Supplier
  • za-smtp-inbound-1.mimecast.co.za
  • za-smtp-inbound-2.mimecast.co.za
speakenglishwithtiffaniacademy.com
-
-
LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy
  • eforward3.registrar-servers.com
  • eforward4.registrar-servers.com
  • eforward5.registrar-servers.com
amrod.co.za
-
-
-
  • za-smtp-inbound-1.mimecast.co.za
  • za-smtp-inbound-2.mimecast.co.za
promoafrica.com
-
-
-
-
promogifts.co.za
-
-
-
  • mail.promogifts.co.za
promoproductsmedia.co.za
-
-
Promotional Products Media
  • _dc-mx.17feb946396e.promoproductsmedia.co.za
deliverypills.com
-
-
하얀고양이 배달대행 - 약배달, 배달약, 배달약국
  • _dc-mx.97a12c24da13.deliverypills.com
pokerlengkap.info
-
-
-
-
pokerku88.info
-
-
Wanderlust - Just another WordPress site
-
pokerpkv.info
-
-
Heart To Heart - Just another WordPress site
-
playpokergame.info
-
-
-
-
cumapoker.info
-
-
-
-
cardgamespoker.info
-
-
-
-
bungapoker.info
-
-
-
-
dayakpoker.info
-
-
-
-
intanpoker.info
-
-
-
-
texaspokercc1.info
-
-
-
-
play-poker-game.info
-
-
E-Commerce Revolution - Just another WordPress site
-
free-poker-money.info
-
-
-
-
pokersoda.info
-
-
-
-
buy-poker-chips.info
-
-
Heart To Heart - Just another WordPress site
-
pokernos.info
-
-
Vacation Dreams - Just another WordPress site
-

WHOIS

WHOIS es un protocolo de consulta y respuesta utilizado para obtener información sobre nombres de dominio y direcciones IP. Se utiliza comúnmente para obtener detalles de registro e información de propiedad de un dominio específico o una dirección IP en Internet. Explore la información más importante que incluye los detalles de registro y la información de contacto administrativo de flash-poker.info. Esto incluye el nombre del propietario, la organización, la dirección de correo electrónico de abuso, el número de teléfono de abuso y las fechas de creación y vencimiento.

Resumen

Fecha de actualización del dominio2022-11-23
Fecha de creación del dominio2022-09-28
Fecha de vencimiento del dominio2023-09-28
Nombre de dominioflash-poker.info
Servidor WHOIS del registradordomains.meshdigital.com
País del titularPK
Correo electrónico del titularPlease query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Correo electrónico de contacto para abuso al registrador[email protected]
Teléfono de contacto para abuso al registrador+1.8779770099

Datos en bruto

whois.nic.info

Domain Name: flash-poker.info Registry Domain ID: 1f2354a0236b41df9d91e3585f10e819-DONUTS Registrar WHOIS Server: domains.meshdigital.com Registrar URL: http://www.domainbox.com Updated Date: 2022-11-23T16:23:54Z Creation Date: 2022-09-28T20:04:40Z Registry Expiry Date: 2023-09-28T20:04:40Z Registrar: Mesh Digital Limited Registrar IANA ID: 1390 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.8779770099 Domain Status: ok https://icann.org/epp#ok Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: PK Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Name Server: zara.ns.cloudflare.com Name Server: dilbert.ns.cloudflare.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-06-30T00:05:56Z <<< For more information on Whois status codes, please visit https://icann.org/epp Terms of Use: Access to WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the registry database. The data in this record is provided by Identity Digital or the Registry Operator for informational purposes only, and accuracy is not guaranteed. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Identity Digital except as reasonably necessary to register domain names or modify existing registrations. When using the Whois service, please consider the following: The Whois service is not a replacement for standard EPP commands to the SRS service. Whois is not considered authoritative for registered domain objects. The Whois service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the Whois services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of Whois service access. Abuse of the Whois system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the Whois records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data provided by Identity Digital can be requested by submitting a request via the form found at https://www.identity.digital/about/policies/whois-layered-access/. The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Identity Digital Inc. and Registry Operator reserve the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

domains.meshdigital.com

Rate limit exceeded. Try again after: 8s

RDAP

RDAP significa Protocolo de Acceso a Datos de Registro. Es un protocolo utilizado para acceder y recuperar datos de registro de recursos de Internet, como nombres de dominio, direcciones IP y números de sistemas autónomos. RDAP tiene varias ventajas sobre el protocolo WHOIS, incluido el soporte para internacionalización, acceso seguro a datos y la capacidad de proporcionar acceso diferenciado a datos de registro. Aquí están los datos brutos de RDAP para flash-poker.info.

Resumen

Fecha de registro2022-09-28
Fecha de vencimiento2023-09-28
Fecha de última modificación2022-11-23
Abuso Teléfono+1.8779770099
Abuso Correo electrónico[email protected]

Datos sin procesar

1{
2        "rdapConformance": [
3                "rdap_level_0",
4                "icann_rdap_response_profile_0",
5                "icann_rdap_technical_implementation_guide_0"
6        ],
7        "notices": [
8                {
9                        "title": "Terms of Service",
10                        "description": [
11                                "Identity Digital Inc. provides this RDAP service for informational purposes only, and to assist persons in obtaining information about or related to a domain name registration record. Identity Digital does not guarantee its accuracy. Users accessing the Identity Digital RDAP service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Identity Digital or any ICANN-accredited registrar, except as reasonably necessary to register domain names or modify existing registrations. When using the Identity Digital RDAP service, please consider the following: the RDAP service is not a replacement for standard EPP commands to the SRS service. RDAP is not considered authoritative for registered domain objects. The RDAP service may be scheduled for downtime during production or OT&E maintenance periods. Queries to the RDAP services are throttled. If too many queries are received from a single IP address within a specified time, the service will begin to reject further queries for a period of time to prevent disruption of RDAP service access. Abuse of the RDAP system through data mining is mitigated by detecting and limiting bulk query access from single sources. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Should you wish to contact the registrant, please refer to the RDAP records available through the registrar URL listed above. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis for accessing the withheld data. Access to this data can be requested by submitting a request via the form found at https://www.identity.digital/about/policies/RDAP-layered-access/ Identity Digital Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy."
12                        ],
13                        "links": [
14                                {
15                                        "value": "https://rdap.donuts.co/rdap/domain/flash-poker.info",
16                                        "rel": "alternate",
17                                        "href": "https://www.identity.digital/about/policies/rdap-access-policy/",
18                                        "type": "text/html"
19                                }
20                        ]
21                },
22                {
23                        "title": "Status Codes",
24                        "description": [
25                                "For more information on domain status codes, please visit https://icann.org/epp"
26                        ],
27                        "links": [
28                                {
29                                        "value": "https://icann.org/epp",
30                                        "rel": "self",
31                                        "href": "https://icann.org/epp",
32                                        "type": "application/rdap+json"
33                                }
34                        ]
35                },
36                {
37                        "title": "RDDS Inaccuracy Complaint Form",
38                        "description": [
39                                "URL of the ICANN RDDS Inaccuracy Complaint Form: https://www.icann.org/wicf"
40                        ],
41                        "links": [
42                                {
43                                        "value": "https://www.icann.org/wicf",
44                                        "rel": "self",
45                                        "href": "https://www.icann.org/wicf",
46                                        "type": "application/rdap+json"
47                                }
48                        ]
49                }
50        ],
51        "ldhName": "flash-poker.info",
52        "unicodeName": "flash-poker.info",
53        "nameservers": [
54                {
55                        "ldhName": "zara.ns.cloudflare.com",
56                        "unicodeName": "zara.ns.cloudflare.com",
57                        "objectClassName": "nameserver",
58                        "handle": "46d1a9a34a9547a1b262899c96b264d8-DONUTS",
59                        "status": [
60                                "associated"
61                        ]
62                },
63                {
64                        "ldhName": "dilbert.ns.cloudflare.com",
65                        "unicodeName": "dilbert.ns.cloudflare.com",
66                        "objectClassName": "nameserver",
67                        "handle": "79a8d09f87d046e882a9441c444bc12e-DONUTS",
68                        "status": [
69                                "associated"
70                        ]
71                }
72        ],
73        "publicIds": [
74                {
75                        "type": "IANA Registrar ID",
76                        "identifier": "1390"
77                }
78        ],
79        "objectClassName": "domain",
80        "handle": "1f2354a0236b41df9d91e3585f10e819-DONUTS",
81        "status": [
82                "active"
83        ],
84        "events": [
85                {
86                        "eventAction": "expiration",
87                        "eventDate": "2023-09-28T20:04:40.211Z"
88                },
89                {
90                        "eventAction": "registration",
91                        "eventDate": "2022-09-28T20:04:40.211Z"
92                },
93                {
94                        "eventAction": "last changed",
95                        "eventDate": "2022-11-23T16:23:54.206Z"
96                },
97                {
98                        "eventAction": "last update of RDAP database",
99                        "eventDate": "2023-06-29T10:59:20.732Z"
100                }
101        ],
102        "entities": [
103                {
104                        "vcardArray": [
105                                "vcard",
106                                [
107                                        [
108                                                "version",
109                                                {},
110                                                "text",
111                                                "4.0"
112                                        ]
113                                ]
114                        ],
115                        "roles": [
116                                "technical"
117                        ],
118                        "objectClassName": "entity",
119                        "remarks": [
120                                {
121                                        "title": "REDACTED FOR PRIVACY",
122                                        "type": "object redacted due to authorization",
123                                        "description": [
124                                                "Some of the data in this object has been removed."
125                                        ]
126                                },
127                                {
128                                        "title": "EMAIL REDACTED FOR PRIVACY",
129                                        "type": "object redacted due to authorization",
130                                        "description": [
131                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
132                                        ]
133                                }
134                        ],
135                        "events": [
136                                {
137                                        "eventAction": "last update of RDAP database",
138                                        "eventDate": "2023-06-29T10:59:20.732Z"
139                                }
140                        ]
141                },
142                {
143                        "vcardArray": [
144                                "vcard",
145                                [
146                                        [
147                                                "version",
148                                                {},
149                                                "text",
150                                                "4.0"
151                                        ],
152                                        [
153                                                "adr",
154                                                {},
155                                                "text",
156                                                [
157                                                        "",
158                                                        "",
159                                                        "",
160                                                        "",
161                                                        "",
162                                                        "",
163                                                        "PK"
164                                                ]
165                                        ]
166                                ]
167                        ],
168                        "roles": [
169                                "registrant"
170                        ],
171                        "objectClassName": "entity",
172                        "remarks": [
173                                {
174                                        "title": "REDACTED FOR PRIVACY",
175                                        "type": "object redacted due to authorization",
176                                        "description": [
177                                                "Some of the data in this object has been removed."
178                                        ]
179                                },
180                                {
181                                        "title": "EMAIL REDACTED FOR PRIVACY",
182                                        "type": "object redacted due to authorization",
183                                        "description": [
184                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
185                                        ]
186                                }
187                        ],
188                        "events": [
189                                {
190                                        "eventAction": "last update of RDAP database",
191                                        "eventDate": "2023-06-29T10:59:20.732Z"
192                                }
193                        ]
194                },
195                {
196                        "vcardArray": [
197                                "vcard",
198                                [
199                                        [
200                                                "version",
201                                                {},
202                                                "text",
203                                                "4.0"
204                                        ]
205                                ]
206                        ],
207                        "roles": [
208                                "administrative"
209                        ],
210                        "objectClassName": "entity",
211                        "remarks": [
212                                {
213                                        "title": "REDACTED FOR PRIVACY",
214                                        "type": "object redacted due to authorization",
215                                        "description": [
216                                                "Some of the data in this object has been removed."
217                                        ]
218                                },
219                                {
220                                        "title": "EMAIL REDACTED FOR PRIVACY",
221                                        "type": "object redacted due to authorization",
222                                        "description": [
223                                                "Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant of the queried domain name."
224                                        ]
225                                }
226                        ],
227                        "events": [
228                                {
229                                        "eventAction": "last update of RDAP database",
230                                        "eventDate": "2023-06-29T10:59:20.732Z"
231                                }
232                        ]
233                },
234                {
235                        "vcardArray": [
236                                "vcard",
237                                [
238                                        [
239                                                "version",
240                                                {},
241                                                "text",
242                                                "4.0"
243                                        ],
244                                        [
245                                                "fn",
246                                                {},
247                                                "text",
248                                                "Mesh Digital Limited"
249                                        ]
250                                ]
251                        ],
252                        "roles": [
253                                "registrar"
254                        ],
255                        "publicIds": [
256                                {
257                                        "type": "IANA Registrar ID",
258                                        "identifier": "1390"
259                                }
260                        ],
261                        "objectClassName": "entity",
262                        "handle": "1390",
263                        "entities": [
264                                {
265                                        "vcardArray": [
266                                                "vcard",
267                                                [
268                                                        [
269                                                                "version",
270                                                                {},
271                                                                "text",
272                                                                "4.0"
273                                                        ],
274                                                        [
275                                                                "tel",
276                                                                {
277                                                                        "type": "voice"
278                                                                },
279                                                                "uri",
280                                                                "tel:+1.8779770099"
281                                                        ],
282                                                        [
283                                                                "email",
284                                                                {},
285                                                                "text",
286                                                                "[email protected]"
287                                                        ]
288                                                ]
289                                        ],
290                                        "roles": [
291                                                "abuse"
292                                        ],
293                                        "objectClassName": "entity",
294                                        "handle": "7c28b56b50294324b1df2fc95bad6ac5-DONUTS"
295                                }
296                        ],
297                        "links": [
298                                {
299                                        "value": "https://rdap.donuts.co/rdap/entity/1390",
300                                        "rel": "self",
301                                        "href": "https://rdap.donuts.co/rdap/entity/1390",
302                                        "type": "application/rdap+json"
303                                }
304                        ]
305                }
306        ],
307        "links": [
308                {
309                        "value": "https://rdap.meshdigital.com/v1/domain/flash-poker.info",
310                        "rel": "related",
311                        "href": "https://rdap.meshdigital.com/v1/domain/flash-poker.info",
312                        "type": "application/rdap+json"
313                },
314                {
315                        "value": "https://rdap.donuts.co/rdap/domain/flash-poker.info",
316                        "rel": "self",
317                        "href": "https://rdap.donuts.co/rdap/domain/flash-poker.info",
318                        "type": "application/rdap+json"
319                }
320        ]
321}

Herramientas Gratuitas

Herramienta de Búsqueda de IP Gratuita

Ingrese una dirección IP para obtener información detallada al respecto, incluyendo ubicación geográfica, proveedor, ASN e información de Whois. Realice un seguimiento y localice direcciones IP.

Buscador de Alternativas de Sitios Web

Examine los sitios web y proporcione una selección de opciones alternativas.

¿Cuál es mi IP?

Toda la información sobre su dirección IP. Ubicación, zona horaria, red, tipo de dirección (IPv4 o IPv6) y más. Vea su IP pública real.

FAQ

¿En qué direcciones IP se aloja flash-poker.info?

Hay 2 direcciones IP alojando flash-poker.info. 172.67.204.23, 104.21.52.210

¿Cuándo expira el dominio flash-poker.info?

flash-poker.info expira en 2023-09-28.

¿Cuándo se registró el dominio flash-poker.info?

flash-poker.info se registró en 2022-09-28.