Domein details

davieswearplatesystems.com

Outlet Online Sale For Women Fashion Apparel,Big Sale For Women's Apparel

New trends in women clothing, high-quality styles up to 85% Off,free Shipping available!,Make an out out statement in curvy clothing designed for glam girls only or nail off-duty style with our new season collection of outfits that are perfect for the everyday. You supply the curves, we supply the trends.

TLDcom
Aanmaakdatum van het domein2022-10-12
Vervaldatum van het domein2023-10-12
Bijgewerkte datum van het domein2022-10-22
E-mailadres voor het melden van misbruik bij de registrar[email protected]
Telefoonnummer voor het melden van misbruik bij de registrar+92.4237421615
ALTERNATIEF
  • https://davieswearplatesystems.com/
  • https://davieswearplatesystems.com/en-ca
DNSCO-HostedWHOISRDAP

DNS

Bekijk domeinsysteemrecords, waaronder, maar niet beperkt tot, A-, CNAME-, MX- en TXT-records.

A

Een A-record (adresrecord) is een type DNS (Domain Name System) record dat een domeinnaam koppelt aan een IPv4 (Internet Protocol versie 4) adres.

NS

Een NS-record (Name Server record) is een type DNS (Domain Name System) record dat aangeeft welke name servers autoritair zijn voor een bepaald domein.
NS RecordIP
sean.ns.cloudflare.com
anahi.ns.cloudflare.com

MX

Een MX-record (Mail Exchange record) is een type DNS (Domain Name System) record dat aangeeft welke mailserver verantwoordelijk is voor het ontvangen van e-mailberichten namens een domein.
UitwisselingPrioriteitIP
us2.mx3.mailhostbox.com10
us2.mx1.mailhostbox.com10
us2.mx2.mailhostbox.com10

TXT

Een TXT-record (Tekstrecord) is een type DNS (Domain Name System) record waarmee je willekeurige tekstinformatie aan een domeinnaam kunt koppelen.
  • v=spf1 redirect=_spf.mailhostbox.com

CO-Hosted

CoHosted verwijst naar een situatie waarin meerdere domeinnamen (websites) hetzelfde IP-adres gebruiken om te verwijzen naar hun respectieve webservers. Ze kunnen eigendom zijn van verschillende individuen of organisaties en kunnen volledig verschillende doeleinden dienen. De domeinen die worden gehost op hetzelfde IP-adres als davieswearplatesystems.com zijn: davieswearplatesystems.com.

WHOIS

WHOIS is een vraag- en antwoordprotocol dat wordt gebruikt om informatie te verkrijgen over domeinnamen en IP-adressen. Het wordt vaak gebruikt om registratiegegevens en eigendomsinformatie op te halen voor een specifieke domeinnaam of IP-adres op internet. Verken de belangrijkste informatie, waaronder registratiegegevens en contactgegevens van de beheerder van davieswearplatesystems.com. Dit omvat de naam van de eigenaar, organisatie, e-mailadres voor misbruik, telefoonnummer voor misbruik, en de creatie- en vervaldatum.

Samenvatting

Bijgewerkte datum van het domein2022-10-22
Aanmaakdatum van het domein2022-10-12
Vervaldatum van het domein2023-10-12
Domeinnaamdavieswearplatesystems.com
Registrar WHOIS-serverwhois.paknic.com
Naam van de registrantWhois Agent
Organisatie van de registrantWeb Domains By Proxy
Straat van de registrantPO Box 23
Stad van de registrantJhang
Staat/provincie van de registrantPunjab
Postcode van de registrant35200
Land van de registrantPK
Telefoon van de registrant+92.477652800
E-mail van de registrant[email protected]
E-mailadres voor het melden van misbruik bij de registrar[email protected]
Telefoonnummer voor het melden van misbruik bij de registrar+92.4237421615

Ruwe gegevens

whois.verisign-grs.com

Domain Name: DAVIESWEARPLATESYSTEMS.COM Registry Domain ID: 2731501366_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.paknic.com Registrar URL: http://https://www.paknic.com Updated Date: 2022-10-22T06:33:19Z Creation Date: 2022-10-12T09:36:42Z Registry Expiry Date: 2023-10-12T09:36:42Z Registrar: PakNIC (Private) Limited Registrar IANA ID: 1367 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.7322978908 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: ANAHI.NS.CLOUDFLARE.COM Name Server: SEAN.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2023-06-29T00:54:27Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.

whois.paknic.com

Domain Name: davieswearplatesystems.com Registry Domain ID: 2731501366_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.paknic.com Registrar URL: http://www.paknic.com/ Updated Date: 2022-10-22T06:33:19Z Creation Date: 2022-10-12T09:36:42Z Registrar Registration Expiration Date: 2023-10-12T09:36:42Z Registrar: Paknic Private Limited Registrar IANA ID: 1367 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +92.4237421615 Reseller: Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: Whois Agent Registrant Organization: Web Domains By Proxy Registrant Street: PO Box 23 Registrant City: Jhang Registrant State/Province: Punjab Registrant Postal Code: 35200 Registrant Country: PK Registrant Phone: +92.477652800 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: [email protected] Registry Admin ID: Admin Name: Whois Agent Admin Organization: Web Domains By Proxy Admin Street: PO Box 23 Admin City: Jhang Admin State/Province: Punjab Admin Postal Code: 35200 Admin Country: PK Admin Phone: +92.477652800 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: [email protected] Registry Tech ID: Tech Name: Whois Agent Tech Organization: Web Domains By Proxy Tech Street: PO Box 23 Tech City: Jhang Tech State/Province: Punjab Tech Postal Code: 35200 Tech Country: PK Tech Phone: +92.477652800 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: [email protected] Name Server: ANAHI.NS.CLOUDFLARE.COM Name Server: SEAN.NS.CLOUDFLARE.COM DNSSEC: Unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-10-22T06:33:19Z <<< NOTICE: WHOIS information is provided by Paknic Private Limited solely for query-based, informational purpose. By querying our WHOIS database, you are agreeing to comply with these terms (https://www.paknic.com/WhoisDisclaimer) so please read them carefully. Any information provided is "as is" without any guarantee of accuracy. You may not use such information to (a) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations; (b) enable high volume, automated, electronic processes that access the systems of Paknic and any of our partners/ affiliates including top-level domain registries, except as reasonably necessary to register domain names or modify existing registrations; or (c) engage in or support unlawful behavior and activities. Paknic reserves the right to restrict or deny your access to the Whois database, and may modify these terms at any time. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

RDAP

RDAP staat voor Registration Data Access Protocol. Het is een protocol dat wordt gebruikt om registratiegegevens voor internetbronnen zoals domeinnamen, IP-adressen en autonome systeemnummers op te halen en te raadplegen. RDAP heeft verschillende voordelen ten opzichte van het WHOIS-protocol, waaronder ondersteuning voor internationalisering, veilige toegang tot gegevens en de mogelijkheid om gedifferentieerde toegang tot registratiegegevens te bieden. Hier zijn de ruwe RDAP-gegevens voor davieswearplatesystems.com.

Samenvatting

Registratiedatum2022-10-12
Vervaldatum2023-10-12
Laatst gewijzigde datum2022-10-22
Misbruik Telefoon+1.7322978908
Misbruik E-mail[email protected]

Ruwe gegevens

1{
2        "objectClassName": "domain",
3        "handle": "2731501366_DOMAIN_COM-VRSN",
4        "ldhName": "DAVIESWEARPLATESYSTEMS.COM",
5        "links": [
6                {
7                        "value": "https://rdap.verisign.com/com/v1/domain/DAVIESWEARPLATESYSTEMS.COM",
8                        "rel": "self",
9                        "href": "https://rdap.verisign.com/com/v1/domain/DAVIESWEARPLATESYSTEMS.COM",
10                        "type": "application/rdap+json"
11                },
12                {
13                        "value": "https://rdap.paknic.com/domain/DAVIESWEARPLATESYSTEMS.COM",
14                        "rel": "related",
15                        "href": "https://rdap.paknic.com/domain/DAVIESWEARPLATESYSTEMS.COM",
16                        "type": "application/rdap+json"
17                }
18        ],
19        "status": [
20                "client transfer prohibited"
21        ],
22        "entities": [
23                {
24                        "objectClassName": "entity",
25                        "handle": "1367",
26                        "roles": [
27                                "registrar"
28                        ],
29                        "publicIds": [
30                                {
31                                        "type": "IANA Registrar ID",
32                                        "identifier": "1367"
33                                }
34                        ],
35                        "vcardArray": [
36                                "vcard",
37                                [
38                                        [
39                                                "version",
40                                                {},
41                                                "text",
42                                                "4.0"
43                                        ],
44                                        [
45                                                "fn",
46                                                {},
47                                                "text",
48                                                "PakNIC (Private) Limited"
49                                        ]
50                                ]
51                        ],
52                        "entities": [
53                                {
54                                        "objectClassName": "entity",
55                                        "roles": [
56                                                "abuse"
57                                        ],
58                                        "vcardArray": [
59                                                "vcard",
60                                                [
61                                                        [
62                                                                "version",
63                                                                {},
64                                                                "text",
65                                                                "4.0"
66                                                        ],
67                                                        [
68                                                                "fn",
69                                                                {},
70                                                                "text",
71                                                                ""
72                                                        ],
73                                                        [
74                                                                "tel",
75                                                                {
76                                                                        "type": "voice"
77                                                                },
78                                                                "uri",
79                                                                "tel:+1.7322978908"
80                                                        ],
81                                                        [
82                                                                "email",
83                                                                {},
84                                                                "text",
85                                                                "[email protected]"
86                                                        ]
87                                                ]
88                                        ]
89                                }
90                        ]
91                }
92        ],
93        "events": [
94                {
95                        "eventAction": "registration",
96                        "eventDate": "2022-10-12T09:36:42Z"
97                },
98                {
99                        "eventAction": "expiration",
100                        "eventDate": "2023-10-12T09:36:42Z"
101                },
102                {
103                        "eventAction": "last changed",
104                        "eventDate": "2022-10-22T06:33:19Z"
105                },
106                {
107                        "eventAction": "last update of RDAP database",
108                        "eventDate": "2023-06-28T19:02:43Z"
109                }
110        ],
111        "secureDNS": {
112                "delegationSigned": false
113        },
114        "nameservers": [
115                {
116                        "objectClassName": "nameserver",
117                        "ldhName": "ANAHI.NS.CLOUDFLARE.COM"
118                },
119                {
120                        "objectClassName": "nameserver",
121                        "ldhName": "SEAN.NS.CLOUDFLARE.COM"
122                }
123        ],
124        "rdapConformance": [
125                "rdap_level_0",
126                "icann_rdap_technical_implementation_guide_0",
127                "icann_rdap_response_profile_0"
128        ],
129        "notices": [
130                {
131                        "title": "Terms of Use",
132                        "description": [
133                                "Service subject to Terms of Use."
134                        ],
135                        "links": [
136                                {
137                                        "href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
138                                        "type": "text/html"
139                                }
140                        ]
141                },
142                {
143                        "title": "Status Codes",
144                        "description": [
145                                "For more information on domain status codes, please visit https://icann.org/epp"
146                        ],
147                        "links": [
148                                {
149                                        "href": "https://icann.org/epp",
150                                        "type": "text/html"
151                                }
152                        ]
153                },
154                {
155                        "title": "RDDS Inaccuracy Complaint Form",
156                        "description": [
157                                "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
158                        ],
159                        "links": [
160                                {
161                                        "href": "https://icann.org/wicf",
162                                        "type": "text/html"
163                                }
164                        ]
165                }
166        ]
167}

Gratis Hulpmiddelen

IP-adres Zoeken

Voer een IP-adres in om gedetailleerde informatie hierover te verkrijgen, inclusief geografische locatie, leverancier, ASN en Whois-informatie. Volg en lokaliseer IP-adressen.

Website Alternatieven Vinder

Onderzoek websites en bied een selectie van alternatieve opties.

Wat is Mijn IP

Alle informatie over uw IP-adres. Locatie, tijdzone, netwerk, adresstype (IPv4 of IPv6) en meer. Zie uw echte openbare IP-adres.

FAQ

Op welke IP-adressen is davieswearplatesystems.com gehost?

Er zijn 2 IP-adressen die davieswearplatesystems.com hosten. 172.67.216.105, 104.21.45.158

Wanneer is davieswearplatesystems.com geregistreerd?

davieswearplatesystems.com is geregistreerd op 2022-10-12.

Wanneer verloopt het domein davieswearplatesystems.com?

davieswearplatesystems.com verloopt op 2023-10-12.