ASN | AS13335 - CLOUDFLARENET |
Bereich | 104.16.0.0/13 |
Unternehmen | CloudFlare Inc. |
Registrierungsdatum | 2014-03-28 |
Datum der letzten Änderung | 2021-05-26 |
Missbrauchs-E-Mail | [email protected] |
Missbrauchs-Telefon | +1-650-319-8930 |
Gehostete Domänen | 24 |
Gehostete Mailserver | 0 |
Gehostete Nameserver | 0 |
Die IP-Geolokalisierung wird verwendet, um den physischen Standort (wie Land, Region, Stadt und Breiten-/Längenkoordinaten) des Geräts, das mit einer bestimmten IP-Adresse verbunden ist, zu bestimmen. Die IP-Adresse 104.21.57.68 befindet sich in United States of America.
Stadt | San Francisco |
Land | United States of America |
Postleitzahl | 94107 |
Zeitzone | -07:00 |
Koordinaten | 37.7757 , -122.3952 |
Zeigt die Liste der auf der IP-Adresse 104.21.57.68 gehosteten Domains an.
DOMAIN | Globaler Rang | Kategorie | Titel | A | MX | NS |
---|---|---|---|---|---|---|
stotaidisurvey.top | 996,146 | - | index | - |
| |
seascapevacationhomes.com | 2,435,506 | Sea Scape Properties - Property Management & Vacation Rentals |
|
| ||
zauers.lv | 2,436,156 | E-Commerce und Online-Shopping | - |
|
| |
oxide.systems | 7,477,733 | - | - |
|
| |
speakenglishwithtiffaniacademy.com | - | - | LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy |
|
| |
covemavernici.com | - | - | - |
|
| |
67prostitutka.ru | - | - | - | - |
| |
telek.top | - | - | Telek.top: Смотреть ТВ онлайн. Бесплатный прямой эфир российских телеканалов. | - |
| |
vulkandeluxe-zx8.top | - | - | - | - |
| |
malatyastyla.com | - | - | - | - |
| |
nova88bets.bet | - | - | - | - |
| |
5ybq.com | - | - | - |
|
| |
cashforhome.com | - | - | We Buy Houses in South Carolina - Sell My House Fast for Cash |
|
| |
tiranetwork.com | - | - | - |
|
| |
mfkmh.xyz | - | - | - | - |
| |
oldstatehouse.com | - | - | - |
|
| |
asianxhamster.name | - | - | Asian Xhamster - Top Destination For Online Asian Porn Gems | - |
| |
adsmark.net | - | - | Ads Market |
|
| |
kanxi123.net | - | - | - | - |
| |
seenunseen.in | - | - | The Seen and the Unseen - a podcast by Amit Varma |
|
| |
schumanclean.com | - | - | Schuman Cleaning |
|
| |
fsgangweishi.com | - | - | 91porn|91PORNF|国产自拍|成人视频|蝌蚪视频|91视频|91自拍 | - |
| |
haberufku.com | - | - | - |
|
| |
ingyenporno.cyou | - | - | - | - |
|
Zeigt die Anzahl der gehosteten Domains, Nameserver und Mailserver der IP-Adresse um 104.21.57.68 an.
RDAP steht für Registration Data Access Protocol. Es handelt sich um ein Protokoll, das verwendet wird, um Registrierungsdaten für Internetressourcen wie Domänennamen, IP-Adressen und autonome Systemnummern abzurufen. RDAP bietet mehrere Vorteile gegenüber dem WHOIS-Protokoll, darunter Unterstützung für Internationalisierung, sicheren Zugriff auf Daten und die Möglichkeit, differenzierten Zugriff auf Registrierungsdaten bereitzustellen. Hier sind die RDAP-Rohdaten für 104.21.57.68.
Name | CLOUDFLARENET |
Registrierungsdatum | 2014-03-28 |
Datum der letzten Änderung | 2021-05-26 |
Routing Telefon | +1-650-319-8930 |
Routing E-Mail | [email protected] |
Missbrauch Telefon | +1-650-319-8930 |
Missbrauch E-Mail | [email protected] |
Verwaltung Telefon | +1-650-319-8930 |
Technisch Telefon | +1-650-319-8930 |
Verwaltung E-Mail | [email protected] |
Technisch E-Mail | [email protected] |
1{
2 "rdapConformance": [
3 "nro_rdap_profile_0",
4 "rdap_level_0",
5 "cidr0",
6 "arin_originas0"
7 ],
8 "notices": [
9 {
10 "title": "Terms of Service",
11 "description": [
12 "By using the ARIN RDAP/Whois service, you are agreeing to the RDAP/Whois Terms of Use"
13 ],
14 "links": [
15 {
16 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
17 "rel": "terms-of-service",
18 "type": "text/html",
19 "href": "https://www.arin.net/resources/registry/whois/tou/"
20 }
21 ]
22 },
23 {
24 "title": "Whois Inaccuracy Reporting",
25 "description": [
26 "If you see inaccuracies in the results, please visit: "
27 ],
28 "links": [
29 {
30 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
31 "rel": "inaccuracy-report",
32 "type": "text/html",
33 "href": "https://www.arin.net/resources/registry/whois/inaccuracy_reporting/"
34 }
35 ]
36 },
37 {
38 "title": "Copyright Notice",
39 "description": [
40 "Copyright 1997-2023, American Registry for Internet Numbers, Ltd."
41 ]
42 }
43 ],
44 "handle": "NET-104-16-0-0-1",
45 "startAddress": "104.16.0.0",
46 "endAddress": "104.31.255.255",
47 "ipVersion": "v4",
48 "name": "CLOUDFLARENET",
49 "type": "DIRECT ALLOCATION",
50 "parentHandle": "NET-104-0-0-0-0",
51 "remarks": [
52 {
53 "title": "Registration Comments",
54 "description": [
55 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
56 ]
57 }
58 ],
59 "events": [
60 {
61 "eventAction": "last changed",
62 "eventDate": "2021-05-26T18:01:10-04:00"
63 },
64 {
65 "eventAction": "registration",
66 "eventDate": "2014-03-28T11:30:55-04:00"
67 }
68 ],
69 "links": [
70 {
71 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
72 "rel": "self",
73 "type": "application/rdap+json",
74 "href": "https://rdap.arin.net/registry/ip/104.16.0.0"
75 },
76 {
77 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
78 "rel": "alternate",
79 "type": "application/xml",
80 "href": "https://whois.arin.net/rest/net/NET-104-16-0-0-1"
81 }
82 ],
83 "entities": [
84 {
85 "handle": "CLOUD14",
86 "vcardArray": [
87 "vcard",
88 [
89 [
90 "version",
91 {},
92 "text",
93 "4.0"
94 ],
95 [
96 "fn",
97 {},
98 "text",
99 "Cloudflare, Inc."
100 ],
101 [
102 "adr",
103 {
104 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
105 },
106 "text",
107 [
108 "",
109 "",
110 "",
111 "",
112 "",
113 "",
114 ""
115 ]
116 ],
117 [
118 "kind",
119 {},
120 "text",
121 "org"
122 ]
123 ]
124 ],
125 "roles": [
126 "registrant"
127 ],
128 "links": [
129 {
130 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
131 "rel": "self",
132 "type": "application/rdap+json",
133 "href": "https://rdap.arin.net/registry/entity/CLOUD14"
134 },
135 {
136 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
137 "rel": "alternate",
138 "type": "application/xml",
139 "href": "https://whois.arin.net/rest/org/CLOUD14"
140 }
141 ],
142 "events": [
143 {
144 "eventAction": "last changed",
145 "eventDate": "2021-07-01T14:16:19-04:00"
146 },
147 {
148 "eventAction": "registration",
149 "eventDate": "2010-07-09T14:10:42-04:00"
150 }
151 ],
152 "entities": [
153 {
154 "handle": "CLOUD146-ARIN",
155 "vcardArray": [
156 "vcard",
157 [
158 [
159 "version",
160 {},
161 "text",
162 "4.0"
163 ],
164 [
165 "adr",
166 {
167 "label": "101 Townsend St\nSan Francsico\nCA\n94107\nUnited States"
168 },
169 "text",
170 [
171 "",
172 "",
173 "",
174 "",
175 "",
176 "",
177 ""
178 ]
179 ],
180 [
181 "fn",
182 {},
183 "text",
184 "Cloudflare-NOC"
185 ],
186 [
187 "org",
188 {},
189 "text",
190 "Cloudflare-NOC"
191 ],
192 [
193 "kind",
194 {},
195 "text",
196 "group"
197 ],
198 [
199 "email",
200 {},
201 "text",
202 "[email protected]"
203 ],
204 [
205 "tel",
206 {
207 "type": [
208 "work",
209 "voice"
210 ]
211 },
212 "text",
213 "+1-650-319-8930"
214 ]
215 ]
216 ],
217 "roles": [
218 "noc",
219 "routing"
220 ],
221 "links": [
222 {
223 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
224 "rel": "self",
225 "type": "application/rdap+json",
226 "href": "https://rdap.arin.net/registry/entity/CLOUD146-ARIN"
227 },
228 {
229 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
230 "rel": "alternate",
231 "type": "application/xml",
232 "href": "https://whois.arin.net/rest/poc/CLOUD146-ARIN"
233 }
234 ],
235 "events": [
236 {
237 "eventAction": "last changed",
238 "eventDate": "2022-08-09T13:36:09-04:00"
239 },
240 {
241 "eventAction": "registration",
242 "eventDate": "2021-07-01T14:10:58-04:00"
243 }
244 ],
245 "status": [
246 "validated"
247 ],
248 "port43": "whois.arin.net",
249 "objectClassName": "entity"
250 },
251 {
252 "handle": "ABUSE2916-ARIN",
253 "vcardArray": [
254 "vcard",
255 [
256 [
257 "version",
258 {},
259 "text",
260 "4.0"
261 ],
262 [
263 "adr",
264 {
265 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
266 },
267 "text",
268 [
269 "",
270 "",
271 "",
272 "",
273 "",
274 "",
275 ""
276 ]
277 ],
278 [
279 "fn",
280 {},
281 "text",
282 "Abuse"
283 ],
284 [
285 "org",
286 {},
287 "text",
288 "Abuse"
289 ],
290 [
291 "kind",
292 {},
293 "text",
294 "group"
295 ],
296 [
297 "email",
298 {},
299 "text",
300 "[email protected]"
301 ],
302 [
303 "tel",
304 {
305 "type": [
306 "work",
307 "voice"
308 ]
309 },
310 "text",
311 "+1-650-319-8930"
312 ]
313 ]
314 ],
315 "roles": [
316 "abuse"
317 ],
318 "remarks": [
319 {
320 "title": "Registration Comments",
321 "description": [
322 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
323 ]
324 },
325 {
326 "title": "Unvalidated POC",
327 "description": [
328 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
329 ]
330 }
331 ],
332 "links": [
333 {
334 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
335 "rel": "self",
336 "type": "application/rdap+json",
337 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
338 },
339 {
340 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
341 "rel": "alternate",
342 "type": "application/xml",
343 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
344 }
345 ],
346 "events": [
347 {
348 "eventAction": "last changed",
349 "eventDate": "2020-04-23T11:06:59-04:00"
350 },
351 {
352 "eventAction": "registration",
353 "eventDate": "2011-02-14T19:00:47-05:00"
354 }
355 ],
356 "port43": "whois.arin.net",
357 "objectClassName": "entity"
358 },
359 {
360 "handle": "ADMIN2521-ARIN",
361 "vcardArray": [
362 "vcard",
363 [
364 [
365 "version",
366 {},
367 "text",
368 "4.0"
369 ],
370 [
371 "adr",
372 {
373 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
374 },
375 "text",
376 [
377 "",
378 "",
379 "",
380 "",
381 "",
382 "",
383 ""
384 ]
385 ],
386 [
387 "fn",
388 {},
389 "text",
390 "Admin"
391 ],
392 [
393 "org",
394 {},
395 "text",
396 "Admin"
397 ],
398 [
399 "kind",
400 {},
401 "text",
402 "group"
403 ],
404 [
405 "email",
406 {},
407 "text",
408 "[email protected]"
409 ],
410 [
411 "tel",
412 {
413 "type": [
414 "work",
415 "voice"
416 ]
417 },
418 "text",
419 "+1-650-319-8930"
420 ]
421 ]
422 ],
423 "roles": [
424 "administrative",
425 "technical"
426 ],
427 "remarks": [
428 {
429 "title": "Registration Comments",
430 "description": [
431 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
432 ]
433 }
434 ],
435 "links": [
436 {
437 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
438 "rel": "self",
439 "type": "application/rdap+json",
440 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
441 },
442 {
443 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
444 "rel": "alternate",
445 "type": "application/xml",
446 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
447 }
448 ],
449 "events": [
450 {
451 "eventAction": "last changed",
452 "eventDate": "2023-01-31T08:56:46-05:00"
453 },
454 {
455 "eventAction": "registration",
456 "eventDate": "2011-04-19T16:11:36-04:00"
457 }
458 ],
459 "status": [
460 "validated"
461 ],
462 "port43": "whois.arin.net",
463 "objectClassName": "entity"
464 }
465 ],
466 "port43": "whois.arin.net",
467 "objectClassName": "entity"
468 },
469 {
470 "handle": "ABUSE2916-ARIN",
471 "vcardArray": [
472 "vcard",
473 [
474 [
475 "version",
476 {},
477 "text",
478 "4.0"
479 ],
480 [
481 "adr",
482 {
483 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
484 },
485 "text",
486 [
487 "",
488 "",
489 "",
490 "",
491 "",
492 "",
493 ""
494 ]
495 ],
496 [
497 "fn",
498 {},
499 "text",
500 "Abuse"
501 ],
502 [
503 "org",
504 {},
505 "text",
506 "Abuse"
507 ],
508 [
509 "kind",
510 {},
511 "text",
512 "group"
513 ],
514 [
515 "email",
516 {},
517 "text",
518 "[email protected]"
519 ],
520 [
521 "tel",
522 {
523 "type": [
524 "work",
525 "voice"
526 ]
527 },
528 "text",
529 "+1-650-319-8930"
530 ]
531 ]
532 ],
533 "roles": [
534 "abuse"
535 ],
536 "remarks": [
537 {
538 "title": "Registration Comments",
539 "description": [
540 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
541 ]
542 },
543 {
544 "title": "Unvalidated POC",
545 "description": [
546 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
547 ]
548 }
549 ],
550 "links": [
551 {
552 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
553 "rel": "self",
554 "type": "application/rdap+json",
555 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
556 },
557 {
558 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
559 "rel": "alternate",
560 "type": "application/xml",
561 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
562 }
563 ],
564 "events": [
565 {
566 "eventAction": "last changed",
567 "eventDate": "2020-04-23T11:06:59-04:00"
568 },
569 {
570 "eventAction": "registration",
571 "eventDate": "2011-02-14T19:00:47-05:00"
572 }
573 ],
574 "port43": "whois.arin.net",
575 "objectClassName": "entity"
576 },
577 {
578 "handle": "ADMIN2521-ARIN",
579 "vcardArray": [
580 "vcard",
581 [
582 [
583 "version",
584 {},
585 "text",
586 "4.0"
587 ],
588 [
589 "adr",
590 {
591 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
592 },
593 "text",
594 [
595 "",
596 "",
597 "",
598 "",
599 "",
600 "",
601 ""
602 ]
603 ],
604 [
605 "fn",
606 {},
607 "text",
608 "Admin"
609 ],
610 [
611 "org",
612 {},
613 "text",
614 "Admin"
615 ],
616 [
617 "kind",
618 {},
619 "text",
620 "group"
621 ],
622 [
623 "email",
624 {},
625 "text",
626 "[email protected]"
627 ],
628 [
629 "tel",
630 {
631 "type": [
632 "work",
633 "voice"
634 ]
635 },
636 "text",
637 "+1-650-319-8930"
638 ]
639 ]
640 ],
641 "roles": [
642 "technical"
643 ],
644 "remarks": [
645 {
646 "title": "Registration Comments",
647 "description": [
648 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
649 ]
650 }
651 ],
652 "links": [
653 {
654 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
655 "rel": "self",
656 "type": "application/rdap+json",
657 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
658 },
659 {
660 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
661 "rel": "alternate",
662 "type": "application/xml",
663 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
664 }
665 ],
666 "events": [
667 {
668 "eventAction": "last changed",
669 "eventDate": "2023-01-31T08:56:46-05:00"
670 },
671 {
672 "eventAction": "registration",
673 "eventDate": "2011-04-19T16:11:36-04:00"
674 }
675 ],
676 "status": [
677 "validated"
678 ],
679 "port43": "whois.arin.net",
680 "objectClassName": "entity"
681 },
682 {
683 "handle": "NOC11962-ARIN",
684 "vcardArray": [
685 "vcard",
686 [
687 [
688 "version",
689 {},
690 "text",
691 "4.0"
692 ],
693 [
694 "adr",
695 {
696 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
697 },
698 "text",
699 [
700 "",
701 "",
702 "",
703 "",
704 "",
705 "",
706 ""
707 ]
708 ],
709 [
710 "fn",
711 {},
712 "text",
713 "NOC"
714 ],
715 [
716 "org",
717 {},
718 "text",
719 "NOC"
720 ],
721 [
722 "kind",
723 {},
724 "text",
725 "group"
726 ],
727 [
728 "email",
729 {},
730 "text",
731 "[email protected]"
732 ],
733 [
734 "tel",
735 {
736 "type": [
737 "work",
738 "voice"
739 ]
740 },
741 "text",
742 "+1-650-319-8930"
743 ]
744 ]
745 ],
746 "roles": [
747 "noc"
748 ],
749 "remarks": [
750 {
751 "title": "Registration Comments",
752 "description": [
753 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
754 ]
755 }
756 ],
757 "links": [
758 {
759 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
760 "rel": "self",
761 "type": "application/rdap+json",
762 "href": "https://rdap.arin.net/registry/entity/NOC11962-ARIN"
763 },
764 {
765 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
766 "rel": "alternate",
767 "type": "application/xml",
768 "href": "https://whois.arin.net/rest/poc/NOC11962-ARIN"
769 }
770 ],
771 "events": [
772 {
773 "eventAction": "last changed",
774 "eventDate": "2022-11-14T00:35:28-05:00"
775 },
776 {
777 "eventAction": "registration",
778 "eventDate": "2011-04-19T16:25:31-04:00"
779 }
780 ],
781 "status": [
782 "validated"
783 ],
784 "port43": "whois.arin.net",
785 "objectClassName": "entity"
786 }
787 ],
788 "port43": "whois.arin.net",
789 "status": [
790 "active"
791 ],
792 "objectClassName": "ip network",
793 "cidr0_cidrs": [
794 {
795 "v4prefix": "104.16.0.0",
796 "length": 12
797 }
798 ],
799 "arin_originas0_originautnums": [
800 13335
801 ]
802}
Geben Sie eine IP-Adresse ein, um detaillierte Informationen dazu zu erhalten, einschließlich geografischer Standort, Anbieter, ASN und Whois-Informationen. Verfolgen und lokalisieren Sie IP-Adressen.
Die ASN von 104.21.57.68 ist 13335, der AS-Name ist CloudFlare Inc.
Es sind 24 Domänen auf 104.21.57.68 gehostet
Das Land von 104.21.57.68 ist United States of America, und die Stadt ist San Francisco. Die Postleitzahl von 104.21.57.68 ist 94107