ASN | AS13335 - CLOUDFLARENET |
Plage | 104.16.0.0/13 |
Entreprise | CloudFlare Inc. |
Date d'enregistrement | 2014-03-28 |
Date de dernière modification | 2021-05-26 |
Email de signalement d'abus | [email protected] |
Téléphone de signalement d'abus | +1-650-319-8930 |
Domaines hébergés | 24 |
Serveurs de messagerie hébergés | 0 |
Serveurs de noms hébergés | 0 |
La géolocalisation IP est utilisée pour déterminer l'emplacement physique (tel que le pays, la région, la ville et les coordonnées de latitude/longitude) de l'appareil associé à une adresse IP spécifique. L'adresse IP 104.21.57.68 est située dans United States of America.
Ville | San Francisco |
Pays | United States of America |
Code postal | 94107 |
Fuseau horaire | -07:00 |
Coordonnées | 37.7757 , -122.3952 |
Affiche la liste des domaines hébergés sur l'adresse IP 104.21.57.68.
DOMAIN | Classement mondial | Catégorie | Titre | A | MX | NS |
---|---|---|---|---|---|---|
stotaidisurvey.top | 996,146 | - | index | - |
| |
seascapevacationhomes.com | 2,435,506 | Sea Scape Properties - Property Management & Vacation Rentals |
|
| ||
zauers.lv | 2,436,156 | E-commerce et achats en ligne | - |
|
| |
oxide.systems | 7,477,733 | - | - |
|
| |
speakenglishwithtiffaniacademy.com | - | - | LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy |
|
| |
covemavernici.com | - | - | - |
|
| |
67prostitutka.ru | - | - | - | - |
| |
telek.top | - | - | Telek.top: Смотреть ТВ онлайн. Бесплатный прямой эфир российских телеканалов. | - |
| |
vulkandeluxe-zx8.top | - | - | - | - |
| |
malatyastyla.com | - | - | - | - |
| |
nova88bets.bet | - | - | - | - |
| |
5ybq.com | - | - | - |
|
| |
cashforhome.com | - | - | We Buy Houses in South Carolina - Sell My House Fast for Cash |
|
| |
tiranetwork.com | - | - | - |
|
| |
mfkmh.xyz | - | - | - | - |
| |
oldstatehouse.com | - | - | - |
|
| |
asianxhamster.name | - | - | Asian Xhamster - Top Destination For Online Asian Porn Gems | - |
| |
adsmark.net | - | - | Ads Market |
|
| |
kanxi123.net | - | - | - | - |
| |
seenunseen.in | - | - | The Seen and the Unseen - a podcast by Amit Varma |
|
| |
schumanclean.com | - | - | Schuman Cleaning |
|
| |
fsgangweishi.com | - | - | 91porn|91PORNF|国产自拍|成人视频|蝌蚪视频|91视频|91自拍 | - |
| |
haberufku.com | - | - | - |
|
| |
ingyenporno.cyou | - | - | - | - |
|
Affiche le nombre de domaines hébergés, de serveurs de noms et de serveurs de messagerie de l'adresse IP autour de 104.21.57.68.
RDAP signifie Protocol d'Accès aux Données d'Enregistrement. Il s'agit d'un protocole utilisé pour accéder et récupérer des données d'enregistrement pour des ressources Internet telles que les noms de domaine, les adresses IP et les numéros de système autonome. RDAP présente plusieurs avantages par rapport au protocole WHOIS, notamment la prise en charge de l'internationalisation, l'accès sécurisé aux données et la possibilité de fournir un accès différencié aux données d'enregistrement. Voici les données brutes de RDAP pour 104.21.57.68.
Nom | CLOUDFLARENET |
Date d'enregistrement | 2014-03-28 |
Date de dernière modification | 2021-05-26 |
Routage Téléphone | +1-650-319-8930 |
Routage Email | [email protected] |
Abus Téléphone | +1-650-319-8930 |
Abus Email | [email protected] |
Administratif Téléphone | +1-650-319-8930 |
Technique Téléphone | +1-650-319-8930 |
Administratif Email | [email protected] |
Technique Email | [email protected] |
1{
2 "rdapConformance": [
3 "nro_rdap_profile_0",
4 "rdap_level_0",
5 "cidr0",
6 "arin_originas0"
7 ],
8 "notices": [
9 {
10 "title": "Terms of Service",
11 "description": [
12 "By using the ARIN RDAP/Whois service, you are agreeing to the RDAP/Whois Terms of Use"
13 ],
14 "links": [
15 {
16 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
17 "rel": "terms-of-service",
18 "type": "text/html",
19 "href": "https://www.arin.net/resources/registry/whois/tou/"
20 }
21 ]
22 },
23 {
24 "title": "Whois Inaccuracy Reporting",
25 "description": [
26 "If you see inaccuracies in the results, please visit: "
27 ],
28 "links": [
29 {
30 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
31 "rel": "inaccuracy-report",
32 "type": "text/html",
33 "href": "https://www.arin.net/resources/registry/whois/inaccuracy_reporting/"
34 }
35 ]
36 },
37 {
38 "title": "Copyright Notice",
39 "description": [
40 "Copyright 1997-2023, American Registry for Internet Numbers, Ltd."
41 ]
42 }
43 ],
44 "handle": "NET-104-16-0-0-1",
45 "startAddress": "104.16.0.0",
46 "endAddress": "104.31.255.255",
47 "ipVersion": "v4",
48 "name": "CLOUDFLARENET",
49 "type": "DIRECT ALLOCATION",
50 "parentHandle": "NET-104-0-0-0-0",
51 "remarks": [
52 {
53 "title": "Registration Comments",
54 "description": [
55 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
56 ]
57 }
58 ],
59 "events": [
60 {
61 "eventAction": "last changed",
62 "eventDate": "2021-05-26T18:01:10-04:00"
63 },
64 {
65 "eventAction": "registration",
66 "eventDate": "2014-03-28T11:30:55-04:00"
67 }
68 ],
69 "links": [
70 {
71 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
72 "rel": "self",
73 "type": "application/rdap+json",
74 "href": "https://rdap.arin.net/registry/ip/104.16.0.0"
75 },
76 {
77 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
78 "rel": "alternate",
79 "type": "application/xml",
80 "href": "https://whois.arin.net/rest/net/NET-104-16-0-0-1"
81 }
82 ],
83 "entities": [
84 {
85 "handle": "CLOUD14",
86 "vcardArray": [
87 "vcard",
88 [
89 [
90 "version",
91 {},
92 "text",
93 "4.0"
94 ],
95 [
96 "fn",
97 {},
98 "text",
99 "Cloudflare, Inc."
100 ],
101 [
102 "adr",
103 {
104 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
105 },
106 "text",
107 [
108 "",
109 "",
110 "",
111 "",
112 "",
113 "",
114 ""
115 ]
116 ],
117 [
118 "kind",
119 {},
120 "text",
121 "org"
122 ]
123 ]
124 ],
125 "roles": [
126 "registrant"
127 ],
128 "links": [
129 {
130 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
131 "rel": "self",
132 "type": "application/rdap+json",
133 "href": "https://rdap.arin.net/registry/entity/CLOUD14"
134 },
135 {
136 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
137 "rel": "alternate",
138 "type": "application/xml",
139 "href": "https://whois.arin.net/rest/org/CLOUD14"
140 }
141 ],
142 "events": [
143 {
144 "eventAction": "last changed",
145 "eventDate": "2021-07-01T14:16:19-04:00"
146 },
147 {
148 "eventAction": "registration",
149 "eventDate": "2010-07-09T14:10:42-04:00"
150 }
151 ],
152 "entities": [
153 {
154 "handle": "CLOUD146-ARIN",
155 "vcardArray": [
156 "vcard",
157 [
158 [
159 "version",
160 {},
161 "text",
162 "4.0"
163 ],
164 [
165 "adr",
166 {
167 "label": "101 Townsend St\nSan Francsico\nCA\n94107\nUnited States"
168 },
169 "text",
170 [
171 "",
172 "",
173 "",
174 "",
175 "",
176 "",
177 ""
178 ]
179 ],
180 [
181 "fn",
182 {},
183 "text",
184 "Cloudflare-NOC"
185 ],
186 [
187 "org",
188 {},
189 "text",
190 "Cloudflare-NOC"
191 ],
192 [
193 "kind",
194 {},
195 "text",
196 "group"
197 ],
198 [
199 "email",
200 {},
201 "text",
202 "[email protected]"
203 ],
204 [
205 "tel",
206 {
207 "type": [
208 "work",
209 "voice"
210 ]
211 },
212 "text",
213 "+1-650-319-8930"
214 ]
215 ]
216 ],
217 "roles": [
218 "noc",
219 "routing"
220 ],
221 "links": [
222 {
223 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
224 "rel": "self",
225 "type": "application/rdap+json",
226 "href": "https://rdap.arin.net/registry/entity/CLOUD146-ARIN"
227 },
228 {
229 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
230 "rel": "alternate",
231 "type": "application/xml",
232 "href": "https://whois.arin.net/rest/poc/CLOUD146-ARIN"
233 }
234 ],
235 "events": [
236 {
237 "eventAction": "last changed",
238 "eventDate": "2022-08-09T13:36:09-04:00"
239 },
240 {
241 "eventAction": "registration",
242 "eventDate": "2021-07-01T14:10:58-04:00"
243 }
244 ],
245 "status": [
246 "validated"
247 ],
248 "port43": "whois.arin.net",
249 "objectClassName": "entity"
250 },
251 {
252 "handle": "ABUSE2916-ARIN",
253 "vcardArray": [
254 "vcard",
255 [
256 [
257 "version",
258 {},
259 "text",
260 "4.0"
261 ],
262 [
263 "adr",
264 {
265 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
266 },
267 "text",
268 [
269 "",
270 "",
271 "",
272 "",
273 "",
274 "",
275 ""
276 ]
277 ],
278 [
279 "fn",
280 {},
281 "text",
282 "Abuse"
283 ],
284 [
285 "org",
286 {},
287 "text",
288 "Abuse"
289 ],
290 [
291 "kind",
292 {},
293 "text",
294 "group"
295 ],
296 [
297 "email",
298 {},
299 "text",
300 "[email protected]"
301 ],
302 [
303 "tel",
304 {
305 "type": [
306 "work",
307 "voice"
308 ]
309 },
310 "text",
311 "+1-650-319-8930"
312 ]
313 ]
314 ],
315 "roles": [
316 "abuse"
317 ],
318 "remarks": [
319 {
320 "title": "Registration Comments",
321 "description": [
322 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
323 ]
324 },
325 {
326 "title": "Unvalidated POC",
327 "description": [
328 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
329 ]
330 }
331 ],
332 "links": [
333 {
334 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
335 "rel": "self",
336 "type": "application/rdap+json",
337 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
338 },
339 {
340 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
341 "rel": "alternate",
342 "type": "application/xml",
343 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
344 }
345 ],
346 "events": [
347 {
348 "eventAction": "last changed",
349 "eventDate": "2020-04-23T11:06:59-04:00"
350 },
351 {
352 "eventAction": "registration",
353 "eventDate": "2011-02-14T19:00:47-05:00"
354 }
355 ],
356 "port43": "whois.arin.net",
357 "objectClassName": "entity"
358 },
359 {
360 "handle": "ADMIN2521-ARIN",
361 "vcardArray": [
362 "vcard",
363 [
364 [
365 "version",
366 {},
367 "text",
368 "4.0"
369 ],
370 [
371 "adr",
372 {
373 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
374 },
375 "text",
376 [
377 "",
378 "",
379 "",
380 "",
381 "",
382 "",
383 ""
384 ]
385 ],
386 [
387 "fn",
388 {},
389 "text",
390 "Admin"
391 ],
392 [
393 "org",
394 {},
395 "text",
396 "Admin"
397 ],
398 [
399 "kind",
400 {},
401 "text",
402 "group"
403 ],
404 [
405 "email",
406 {},
407 "text",
408 "[email protected]"
409 ],
410 [
411 "tel",
412 {
413 "type": [
414 "work",
415 "voice"
416 ]
417 },
418 "text",
419 "+1-650-319-8930"
420 ]
421 ]
422 ],
423 "roles": [
424 "administrative",
425 "technical"
426 ],
427 "remarks": [
428 {
429 "title": "Registration Comments",
430 "description": [
431 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
432 ]
433 }
434 ],
435 "links": [
436 {
437 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
438 "rel": "self",
439 "type": "application/rdap+json",
440 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
441 },
442 {
443 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
444 "rel": "alternate",
445 "type": "application/xml",
446 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
447 }
448 ],
449 "events": [
450 {
451 "eventAction": "last changed",
452 "eventDate": "2023-01-31T08:56:46-05:00"
453 },
454 {
455 "eventAction": "registration",
456 "eventDate": "2011-04-19T16:11:36-04:00"
457 }
458 ],
459 "status": [
460 "validated"
461 ],
462 "port43": "whois.arin.net",
463 "objectClassName": "entity"
464 }
465 ],
466 "port43": "whois.arin.net",
467 "objectClassName": "entity"
468 },
469 {
470 "handle": "ABUSE2916-ARIN",
471 "vcardArray": [
472 "vcard",
473 [
474 [
475 "version",
476 {},
477 "text",
478 "4.0"
479 ],
480 [
481 "adr",
482 {
483 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
484 },
485 "text",
486 [
487 "",
488 "",
489 "",
490 "",
491 "",
492 "",
493 ""
494 ]
495 ],
496 [
497 "fn",
498 {},
499 "text",
500 "Abuse"
501 ],
502 [
503 "org",
504 {},
505 "text",
506 "Abuse"
507 ],
508 [
509 "kind",
510 {},
511 "text",
512 "group"
513 ],
514 [
515 "email",
516 {},
517 "text",
518 "[email protected]"
519 ],
520 [
521 "tel",
522 {
523 "type": [
524 "work",
525 "voice"
526 ]
527 },
528 "text",
529 "+1-650-319-8930"
530 ]
531 ]
532 ],
533 "roles": [
534 "abuse"
535 ],
536 "remarks": [
537 {
538 "title": "Registration Comments",
539 "description": [
540 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
541 ]
542 },
543 {
544 "title": "Unvalidated POC",
545 "description": [
546 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
547 ]
548 }
549 ],
550 "links": [
551 {
552 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
553 "rel": "self",
554 "type": "application/rdap+json",
555 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
556 },
557 {
558 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
559 "rel": "alternate",
560 "type": "application/xml",
561 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
562 }
563 ],
564 "events": [
565 {
566 "eventAction": "last changed",
567 "eventDate": "2020-04-23T11:06:59-04:00"
568 },
569 {
570 "eventAction": "registration",
571 "eventDate": "2011-02-14T19:00:47-05:00"
572 }
573 ],
574 "port43": "whois.arin.net",
575 "objectClassName": "entity"
576 },
577 {
578 "handle": "ADMIN2521-ARIN",
579 "vcardArray": [
580 "vcard",
581 [
582 [
583 "version",
584 {},
585 "text",
586 "4.0"
587 ],
588 [
589 "adr",
590 {
591 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
592 },
593 "text",
594 [
595 "",
596 "",
597 "",
598 "",
599 "",
600 "",
601 ""
602 ]
603 ],
604 [
605 "fn",
606 {},
607 "text",
608 "Admin"
609 ],
610 [
611 "org",
612 {},
613 "text",
614 "Admin"
615 ],
616 [
617 "kind",
618 {},
619 "text",
620 "group"
621 ],
622 [
623 "email",
624 {},
625 "text",
626 "[email protected]"
627 ],
628 [
629 "tel",
630 {
631 "type": [
632 "work",
633 "voice"
634 ]
635 },
636 "text",
637 "+1-650-319-8930"
638 ]
639 ]
640 ],
641 "roles": [
642 "technical"
643 ],
644 "remarks": [
645 {
646 "title": "Registration Comments",
647 "description": [
648 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
649 ]
650 }
651 ],
652 "links": [
653 {
654 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
655 "rel": "self",
656 "type": "application/rdap+json",
657 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
658 },
659 {
660 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
661 "rel": "alternate",
662 "type": "application/xml",
663 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
664 }
665 ],
666 "events": [
667 {
668 "eventAction": "last changed",
669 "eventDate": "2023-01-31T08:56:46-05:00"
670 },
671 {
672 "eventAction": "registration",
673 "eventDate": "2011-04-19T16:11:36-04:00"
674 }
675 ],
676 "status": [
677 "validated"
678 ],
679 "port43": "whois.arin.net",
680 "objectClassName": "entity"
681 },
682 {
683 "handle": "NOC11962-ARIN",
684 "vcardArray": [
685 "vcard",
686 [
687 [
688 "version",
689 {},
690 "text",
691 "4.0"
692 ],
693 [
694 "adr",
695 {
696 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
697 },
698 "text",
699 [
700 "",
701 "",
702 "",
703 "",
704 "",
705 "",
706 ""
707 ]
708 ],
709 [
710 "fn",
711 {},
712 "text",
713 "NOC"
714 ],
715 [
716 "org",
717 {},
718 "text",
719 "NOC"
720 ],
721 [
722 "kind",
723 {},
724 "text",
725 "group"
726 ],
727 [
728 "email",
729 {},
730 "text",
731 "[email protected]"
732 ],
733 [
734 "tel",
735 {
736 "type": [
737 "work",
738 "voice"
739 ]
740 },
741 "text",
742 "+1-650-319-8930"
743 ]
744 ]
745 ],
746 "roles": [
747 "noc"
748 ],
749 "remarks": [
750 {
751 "title": "Registration Comments",
752 "description": [
753 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
754 ]
755 }
756 ],
757 "links": [
758 {
759 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
760 "rel": "self",
761 "type": "application/rdap+json",
762 "href": "https://rdap.arin.net/registry/entity/NOC11962-ARIN"
763 },
764 {
765 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
766 "rel": "alternate",
767 "type": "application/xml",
768 "href": "https://whois.arin.net/rest/poc/NOC11962-ARIN"
769 }
770 ],
771 "events": [
772 {
773 "eventAction": "last changed",
774 "eventDate": "2022-11-14T00:35:28-05:00"
775 },
776 {
777 "eventAction": "registration",
778 "eventDate": "2011-04-19T16:25:31-04:00"
779 }
780 ],
781 "status": [
782 "validated"
783 ],
784 "port43": "whois.arin.net",
785 "objectClassName": "entity"
786 }
787 ],
788 "port43": "whois.arin.net",
789 "status": [
790 "active"
791 ],
792 "objectClassName": "ip network",
793 "cidr0_cidrs": [
794 {
795 "v4prefix": "104.16.0.0",
796 "length": 12
797 }
798 ],
799 "arin_originas0_originautnums": [
800 13335
801 ]
802}
Entrez une adresse IP pour obtenir des informations détaillées à son sujet, y compris la localisation géographique, le fournisseur, l'ASN et les informations Whois. Suivez et localisez les adresses IP.
L'ASN de 104.21.57.68 est 13335, et le nom AS est CloudFlare Inc.
24 domaines sont hébergés sur 104.21.57.68
Le pays de 104.21.57.68 est United States of America, et sa ville est San Francisco. Le code postal de 104.21.57.68 est 94107