ASN | AS13335 - CLOUDFLARENET |
Julat | 104.16.0.0/13 |
Syarikat | CloudFlare Inc. |
Tarikh Pendaftaran | 2014-03-28 |
Tarikh Terakhir Diubah | 2021-05-26 |
EMEL Penyalahgunaan | [email protected] |
Telefon Penyalahgunaan | +1-650-319-8930 |
Domain Dihoskan | 24 |
Pelayan Emel Dihoskan | 0 |
Pelayan Nama Dihoskan | 0 |
Geolokasi IP digunakan untuk menentukan lokasi fizikal (seperti negara, kawasan, bandar, dan koordinat latitud/longitud) peranti yang berkaitan dengan alamat IP tertentu. Alamat IP 104.21.57.68 terletak di United States of America.
Bandar | San Francisco |
Negara | United States of America |
Poskod | 94107 |
Zon Waktu | -07:00 |
Koordinat | 37.7757 , -122.3952 |
Menunjukkan senarai domain yang dihoskan pada alamat IP 104.21.57.68.
DOMAIN | Pangkat Global | Kategori | Tajuk | A | MX | NS |
---|---|---|---|---|---|---|
stotaidisurvey.top | 996,146 | - | index | - |
| |
seascapevacationhomes.com | 2,435,506 | Sea Scape Properties - Property Management & Vacation Rentals |
|
| ||
zauers.lv | 2,436,156 | E-dagang dan Pembelian dalam Talian | - |
|
| |
oxide.systems | 7,477,733 | - | - |
|
| |
speakenglishwithtiffaniacademy.com | - | - | LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy |
|
| |
covemavernici.com | - | - | - |
|
| |
67prostitutka.ru | - | - | - | - |
| |
telek.top | - | - | Telek.top: Смотреть ТВ онлайн. Бесплатный прямой эфир российских телеканалов. | - |
| |
vulkandeluxe-zx8.top | - | - | - | - |
| |
malatyastyla.com | - | - | - | - |
| |
nova88bets.bet | - | - | - | - |
| |
5ybq.com | - | - | - |
|
| |
cashforhome.com | - | - | We Buy Houses in South Carolina - Sell My House Fast for Cash |
|
| |
tiranetwork.com | - | - | - |
|
| |
mfkmh.xyz | - | - | - | - |
| |
oldstatehouse.com | - | - | - |
|
| |
asianxhamster.name | - | - | Asian Xhamster - Top Destination For Online Asian Porn Gems | - |
| |
adsmark.net | - | - | Ads Market |
|
| |
kanxi123.net | - | - | - | - |
| |
seenunseen.in | - | - | The Seen and the Unseen - a podcast by Amit Varma |
|
| |
schumanclean.com | - | - | Schuman Cleaning |
|
| |
fsgangweishi.com | - | - | 91porn|91PORNF|国产自拍|成人视频|蝌蚪视频|91视频|91自拍 | - |
| |
haberufku.com | - | - | - |
|
| |
ingyenporno.cyou | - | - | - | - |
|
Menunjukkan jumlah domain yang dihoskan, pelayan nama, dan pelayan emel alamat IP di sekitar 104.21.57.68.
RDAP merujuk kepada Protokol Akses Data Pendaftaran. Ia adalah protokol yang digunakan untuk mengakses dan mendapatkan data pendaftaran untuk sumber internet seperti nama domain, alamat IP, dan nombor sistem autonomi. RDAP mempunyai beberapa kelebihan berbanding protokol WHOIS, termasuk sokongan untuk pengantarabangsaan, akses selamat kepada data, dan keupayaan untuk menyediakan akses yang berbeza kepada data pendaftaran. Berikut adalah data mentah RDAP untuk 104.21.57.68.
Nama | CLOUDFLARENET |
Tarikh Pendaftaran | 2014-03-28 |
Tarikh Terakhir Diubah | 2021-05-26 |
Pemangkinan Telefon | +1-650-319-8930 |
Pemangkinan EMEL | [email protected] |
Penyalahgunaan Telefon | +1-650-319-8930 |
Penyalahgunaan EMEL | [email protected] |
Administratif Telefon | +1-650-319-8930 |
Teknikal Telefon | +1-650-319-8930 |
Administratif EMEL | [email protected] |
Teknikal EMEL | [email protected] |
1{
2 "rdapConformance": [
3 "nro_rdap_profile_0",
4 "rdap_level_0",
5 "cidr0",
6 "arin_originas0"
7 ],
8 "notices": [
9 {
10 "title": "Terms of Service",
11 "description": [
12 "By using the ARIN RDAP/Whois service, you are agreeing to the RDAP/Whois Terms of Use"
13 ],
14 "links": [
15 {
16 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
17 "rel": "terms-of-service",
18 "type": "text/html",
19 "href": "https://www.arin.net/resources/registry/whois/tou/"
20 }
21 ]
22 },
23 {
24 "title": "Whois Inaccuracy Reporting",
25 "description": [
26 "If you see inaccuracies in the results, please visit: "
27 ],
28 "links": [
29 {
30 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
31 "rel": "inaccuracy-report",
32 "type": "text/html",
33 "href": "https://www.arin.net/resources/registry/whois/inaccuracy_reporting/"
34 }
35 ]
36 },
37 {
38 "title": "Copyright Notice",
39 "description": [
40 "Copyright 1997-2023, American Registry for Internet Numbers, Ltd."
41 ]
42 }
43 ],
44 "handle": "NET-104-16-0-0-1",
45 "startAddress": "104.16.0.0",
46 "endAddress": "104.31.255.255",
47 "ipVersion": "v4",
48 "name": "CLOUDFLARENET",
49 "type": "DIRECT ALLOCATION",
50 "parentHandle": "NET-104-0-0-0-0",
51 "remarks": [
52 {
53 "title": "Registration Comments",
54 "description": [
55 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
56 ]
57 }
58 ],
59 "events": [
60 {
61 "eventAction": "last changed",
62 "eventDate": "2021-05-26T18:01:10-04:00"
63 },
64 {
65 "eventAction": "registration",
66 "eventDate": "2014-03-28T11:30:55-04:00"
67 }
68 ],
69 "links": [
70 {
71 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
72 "rel": "self",
73 "type": "application/rdap+json",
74 "href": "https://rdap.arin.net/registry/ip/104.16.0.0"
75 },
76 {
77 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
78 "rel": "alternate",
79 "type": "application/xml",
80 "href": "https://whois.arin.net/rest/net/NET-104-16-0-0-1"
81 }
82 ],
83 "entities": [
84 {
85 "handle": "CLOUD14",
86 "vcardArray": [
87 "vcard",
88 [
89 [
90 "version",
91 {},
92 "text",
93 "4.0"
94 ],
95 [
96 "fn",
97 {},
98 "text",
99 "Cloudflare, Inc."
100 ],
101 [
102 "adr",
103 {
104 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
105 },
106 "text",
107 [
108 "",
109 "",
110 "",
111 "",
112 "",
113 "",
114 ""
115 ]
116 ],
117 [
118 "kind",
119 {},
120 "text",
121 "org"
122 ]
123 ]
124 ],
125 "roles": [
126 "registrant"
127 ],
128 "links": [
129 {
130 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
131 "rel": "self",
132 "type": "application/rdap+json",
133 "href": "https://rdap.arin.net/registry/entity/CLOUD14"
134 },
135 {
136 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
137 "rel": "alternate",
138 "type": "application/xml",
139 "href": "https://whois.arin.net/rest/org/CLOUD14"
140 }
141 ],
142 "events": [
143 {
144 "eventAction": "last changed",
145 "eventDate": "2021-07-01T14:16:19-04:00"
146 },
147 {
148 "eventAction": "registration",
149 "eventDate": "2010-07-09T14:10:42-04:00"
150 }
151 ],
152 "entities": [
153 {
154 "handle": "CLOUD146-ARIN",
155 "vcardArray": [
156 "vcard",
157 [
158 [
159 "version",
160 {},
161 "text",
162 "4.0"
163 ],
164 [
165 "adr",
166 {
167 "label": "101 Townsend St\nSan Francsico\nCA\n94107\nUnited States"
168 },
169 "text",
170 [
171 "",
172 "",
173 "",
174 "",
175 "",
176 "",
177 ""
178 ]
179 ],
180 [
181 "fn",
182 {},
183 "text",
184 "Cloudflare-NOC"
185 ],
186 [
187 "org",
188 {},
189 "text",
190 "Cloudflare-NOC"
191 ],
192 [
193 "kind",
194 {},
195 "text",
196 "group"
197 ],
198 [
199 "email",
200 {},
201 "text",
202 "[email protected]"
203 ],
204 [
205 "tel",
206 {
207 "type": [
208 "work",
209 "voice"
210 ]
211 },
212 "text",
213 "+1-650-319-8930"
214 ]
215 ]
216 ],
217 "roles": [
218 "noc",
219 "routing"
220 ],
221 "links": [
222 {
223 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
224 "rel": "self",
225 "type": "application/rdap+json",
226 "href": "https://rdap.arin.net/registry/entity/CLOUD146-ARIN"
227 },
228 {
229 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
230 "rel": "alternate",
231 "type": "application/xml",
232 "href": "https://whois.arin.net/rest/poc/CLOUD146-ARIN"
233 }
234 ],
235 "events": [
236 {
237 "eventAction": "last changed",
238 "eventDate": "2022-08-09T13:36:09-04:00"
239 },
240 {
241 "eventAction": "registration",
242 "eventDate": "2021-07-01T14:10:58-04:00"
243 }
244 ],
245 "status": [
246 "validated"
247 ],
248 "port43": "whois.arin.net",
249 "objectClassName": "entity"
250 },
251 {
252 "handle": "ABUSE2916-ARIN",
253 "vcardArray": [
254 "vcard",
255 [
256 [
257 "version",
258 {},
259 "text",
260 "4.0"
261 ],
262 [
263 "adr",
264 {
265 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
266 },
267 "text",
268 [
269 "",
270 "",
271 "",
272 "",
273 "",
274 "",
275 ""
276 ]
277 ],
278 [
279 "fn",
280 {},
281 "text",
282 "Abuse"
283 ],
284 [
285 "org",
286 {},
287 "text",
288 "Abuse"
289 ],
290 [
291 "kind",
292 {},
293 "text",
294 "group"
295 ],
296 [
297 "email",
298 {},
299 "text",
300 "[email protected]"
301 ],
302 [
303 "tel",
304 {
305 "type": [
306 "work",
307 "voice"
308 ]
309 },
310 "text",
311 "+1-650-319-8930"
312 ]
313 ]
314 ],
315 "roles": [
316 "abuse"
317 ],
318 "remarks": [
319 {
320 "title": "Registration Comments",
321 "description": [
322 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
323 ]
324 },
325 {
326 "title": "Unvalidated POC",
327 "description": [
328 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
329 ]
330 }
331 ],
332 "links": [
333 {
334 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
335 "rel": "self",
336 "type": "application/rdap+json",
337 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
338 },
339 {
340 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
341 "rel": "alternate",
342 "type": "application/xml",
343 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
344 }
345 ],
346 "events": [
347 {
348 "eventAction": "last changed",
349 "eventDate": "2020-04-23T11:06:59-04:00"
350 },
351 {
352 "eventAction": "registration",
353 "eventDate": "2011-02-14T19:00:47-05:00"
354 }
355 ],
356 "port43": "whois.arin.net",
357 "objectClassName": "entity"
358 },
359 {
360 "handle": "ADMIN2521-ARIN",
361 "vcardArray": [
362 "vcard",
363 [
364 [
365 "version",
366 {},
367 "text",
368 "4.0"
369 ],
370 [
371 "adr",
372 {
373 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
374 },
375 "text",
376 [
377 "",
378 "",
379 "",
380 "",
381 "",
382 "",
383 ""
384 ]
385 ],
386 [
387 "fn",
388 {},
389 "text",
390 "Admin"
391 ],
392 [
393 "org",
394 {},
395 "text",
396 "Admin"
397 ],
398 [
399 "kind",
400 {},
401 "text",
402 "group"
403 ],
404 [
405 "email",
406 {},
407 "text",
408 "[email protected]"
409 ],
410 [
411 "tel",
412 {
413 "type": [
414 "work",
415 "voice"
416 ]
417 },
418 "text",
419 "+1-650-319-8930"
420 ]
421 ]
422 ],
423 "roles": [
424 "administrative",
425 "technical"
426 ],
427 "remarks": [
428 {
429 "title": "Registration Comments",
430 "description": [
431 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
432 ]
433 }
434 ],
435 "links": [
436 {
437 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
438 "rel": "self",
439 "type": "application/rdap+json",
440 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
441 },
442 {
443 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
444 "rel": "alternate",
445 "type": "application/xml",
446 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
447 }
448 ],
449 "events": [
450 {
451 "eventAction": "last changed",
452 "eventDate": "2023-01-31T08:56:46-05:00"
453 },
454 {
455 "eventAction": "registration",
456 "eventDate": "2011-04-19T16:11:36-04:00"
457 }
458 ],
459 "status": [
460 "validated"
461 ],
462 "port43": "whois.arin.net",
463 "objectClassName": "entity"
464 }
465 ],
466 "port43": "whois.arin.net",
467 "objectClassName": "entity"
468 },
469 {
470 "handle": "ABUSE2916-ARIN",
471 "vcardArray": [
472 "vcard",
473 [
474 [
475 "version",
476 {},
477 "text",
478 "4.0"
479 ],
480 [
481 "adr",
482 {
483 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
484 },
485 "text",
486 [
487 "",
488 "",
489 "",
490 "",
491 "",
492 "",
493 ""
494 ]
495 ],
496 [
497 "fn",
498 {},
499 "text",
500 "Abuse"
501 ],
502 [
503 "org",
504 {},
505 "text",
506 "Abuse"
507 ],
508 [
509 "kind",
510 {},
511 "text",
512 "group"
513 ],
514 [
515 "email",
516 {},
517 "text",
518 "[email protected]"
519 ],
520 [
521 "tel",
522 {
523 "type": [
524 "work",
525 "voice"
526 ]
527 },
528 "text",
529 "+1-650-319-8930"
530 ]
531 ]
532 ],
533 "roles": [
534 "abuse"
535 ],
536 "remarks": [
537 {
538 "title": "Registration Comments",
539 "description": [
540 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
541 ]
542 },
543 {
544 "title": "Unvalidated POC",
545 "description": [
546 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
547 ]
548 }
549 ],
550 "links": [
551 {
552 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
553 "rel": "self",
554 "type": "application/rdap+json",
555 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
556 },
557 {
558 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
559 "rel": "alternate",
560 "type": "application/xml",
561 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
562 }
563 ],
564 "events": [
565 {
566 "eventAction": "last changed",
567 "eventDate": "2020-04-23T11:06:59-04:00"
568 },
569 {
570 "eventAction": "registration",
571 "eventDate": "2011-02-14T19:00:47-05:00"
572 }
573 ],
574 "port43": "whois.arin.net",
575 "objectClassName": "entity"
576 },
577 {
578 "handle": "ADMIN2521-ARIN",
579 "vcardArray": [
580 "vcard",
581 [
582 [
583 "version",
584 {},
585 "text",
586 "4.0"
587 ],
588 [
589 "adr",
590 {
591 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
592 },
593 "text",
594 [
595 "",
596 "",
597 "",
598 "",
599 "",
600 "",
601 ""
602 ]
603 ],
604 [
605 "fn",
606 {},
607 "text",
608 "Admin"
609 ],
610 [
611 "org",
612 {},
613 "text",
614 "Admin"
615 ],
616 [
617 "kind",
618 {},
619 "text",
620 "group"
621 ],
622 [
623 "email",
624 {},
625 "text",
626 "[email protected]"
627 ],
628 [
629 "tel",
630 {
631 "type": [
632 "work",
633 "voice"
634 ]
635 },
636 "text",
637 "+1-650-319-8930"
638 ]
639 ]
640 ],
641 "roles": [
642 "technical"
643 ],
644 "remarks": [
645 {
646 "title": "Registration Comments",
647 "description": [
648 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
649 ]
650 }
651 ],
652 "links": [
653 {
654 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
655 "rel": "self",
656 "type": "application/rdap+json",
657 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
658 },
659 {
660 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
661 "rel": "alternate",
662 "type": "application/xml",
663 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
664 }
665 ],
666 "events": [
667 {
668 "eventAction": "last changed",
669 "eventDate": "2023-01-31T08:56:46-05:00"
670 },
671 {
672 "eventAction": "registration",
673 "eventDate": "2011-04-19T16:11:36-04:00"
674 }
675 ],
676 "status": [
677 "validated"
678 ],
679 "port43": "whois.arin.net",
680 "objectClassName": "entity"
681 },
682 {
683 "handle": "NOC11962-ARIN",
684 "vcardArray": [
685 "vcard",
686 [
687 [
688 "version",
689 {},
690 "text",
691 "4.0"
692 ],
693 [
694 "adr",
695 {
696 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
697 },
698 "text",
699 [
700 "",
701 "",
702 "",
703 "",
704 "",
705 "",
706 ""
707 ]
708 ],
709 [
710 "fn",
711 {},
712 "text",
713 "NOC"
714 ],
715 [
716 "org",
717 {},
718 "text",
719 "NOC"
720 ],
721 [
722 "kind",
723 {},
724 "text",
725 "group"
726 ],
727 [
728 "email",
729 {},
730 "text",
731 "[email protected]"
732 ],
733 [
734 "tel",
735 {
736 "type": [
737 "work",
738 "voice"
739 ]
740 },
741 "text",
742 "+1-650-319-8930"
743 ]
744 ]
745 ],
746 "roles": [
747 "noc"
748 ],
749 "remarks": [
750 {
751 "title": "Registration Comments",
752 "description": [
753 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
754 ]
755 }
756 ],
757 "links": [
758 {
759 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
760 "rel": "self",
761 "type": "application/rdap+json",
762 "href": "https://rdap.arin.net/registry/entity/NOC11962-ARIN"
763 },
764 {
765 "value": "https://rdap.arin.net/registry/ip/104.16.0.0",
766 "rel": "alternate",
767 "type": "application/xml",
768 "href": "https://whois.arin.net/rest/poc/NOC11962-ARIN"
769 }
770 ],
771 "events": [
772 {
773 "eventAction": "last changed",
774 "eventDate": "2022-11-14T00:35:28-05:00"
775 },
776 {
777 "eventAction": "registration",
778 "eventDate": "2011-04-19T16:25:31-04:00"
779 }
780 ],
781 "status": [
782 "validated"
783 ],
784 "port43": "whois.arin.net",
785 "objectClassName": "entity"
786 }
787 ],
788 "port43": "whois.arin.net",
789 "status": [
790 "active"
791 ],
792 "objectClassName": "ip network",
793 "cidr0_cidrs": [
794 {
795 "v4prefix": "104.16.0.0",
796 "length": 12
797 }
798 ],
799 "arin_originas0_originautnums": [
800 13335
801 ]
802}
ASN bagi 104.21.57.68 ialah 13335, Nama AS ialah CloudFlare Inc.
24 domain dihoskan pada 104.21.57.68
Negara bagi 104.21.57.68 adalah United States of America, dan bandarnya adalah San Francisco. Poskod bagi 104.21.57.68 adalah 94107