Domain details

5ybq.com

5ybq.com
TLDcom
Domain Created Date2022-08-21
Domain Expiry Date2023-08-21
Domain Updated Date2022-11-25
Registrar Abuse Contact Email[email protected]
Registrar Abuse Contact Phone+39.05520021555
DNSCO-HostedWHOISRDAP

DNS

View domain system records, including but not limited to the A, CNAME, MX, and TXT records.

A

DNS A record (Address record) is a type of DNS (Domain Name System) record that maps a domain name to an IPv4 (Internet Protocol version 4) address.

NS

DNS NS record (Name Server record) is a type of DNS (Domain Name System) record that specifies which name servers are authoritative for a particular domain.
NS RecordIP
gabriel.ns.cloudflare.com
aspen.ns.cloudflare.com

MX

MX record (Mail Exchange record) is a type of DNS (Domain Name System) record that specifies the mail server responsible for receiving email messages on behalf of a domain.
ExchangePriorityIP
yandex.net10

CO-Hosted

CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as 5ybq.com has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.

WHOIS

WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of 5ybq.com. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.

Summary

Domain Updated Date2022-11-25
Domain Created Date2022-08-21
Domain Expiry Date2023-08-21
Domain Name5YBQ.COM
Registrar WHOIS Serverwhois.register.it
Registrant State/ProvinceHERBLAY
Registrant CountryFR
Registrant Emailhttps://domaincontact.register.it/contact-domain
Registrar Abuse Contact Email[email protected]
Registrar Abuse Contact Phone+39.05520021555

Raw data

whois.verisign-grs.com

Domain Name: 5YBQ.COM Registry Domain ID: 2719676311_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.register.it Registrar URL: http://www.register.it Updated Date: 2022-11-25T21:17:15Z Creation Date: 2022-08-21T06:58:10Z Registry Expiry Date: 2023-08-21T06:58:10Z Registrar: Register SPA Registrar IANA ID: 168 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +39.05520021555 Domain Status: ok https://icann.org/epp#ok Name Server: ASPEN.NS.CLOUDFLARE.COM Name Server: GABRIEL.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2023-06-29T12:20:38Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.

whois.register.it

Domain Name: 5YBQ.COM Registry Domain ID: 2719676311_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.register.it Registrar URL: http://we.register.it Updated Date: 2022-11-25T00:00:00Z Creation Date: 2022-08-21T00:00:00Z Registrar Registration Expiration Date: 2023-08-21T00:00:00Z Registrar: REGISTER S.P.A. Registrar IANA ID: 168 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +39.05520021555 Reseller: Domain Status: ok https://icann.org/epp#ok Registry Registrant ID: Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: HERBLAY Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: FR Registrant Phone: REDACTED.FORPRIVACY Registrant Phone Ext: Registrant Fax: REDACTED.FORPRIVACY Registrant Fax Ext: Registrant Email: https://domaincontact.register.it/contact-domain Registry Admin ID: Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED.FORPRIVACY Admin Phone Ext: Admin Fax: REDACTED.FORPRIVACY Admin Fax Ext: Admin Email: https://domaincontact.register.it/contact-domain Registry Tech ID: Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED.FORPRIVACY Tech Phone Ext: Tech Fax: REDACTED.FORPRIVACY Tech Fax Ext: Tech Email: https://domaincontact.register.it/contact-domain Name Server: ASPEN.NS.CLOUDFLARE.COM Name Server: GABRIEL.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of whois database: 2023-06-29T12:20:55Z <<< For more information on Whois status codes, please visit https://icann.org/epp

RDAP

RDAP stands for Registration Data Access Protocol. It is a protocol used to access and retrieve registration data for internet resources such as domain names, IP addresses, and autonomous system numbers. RDAP has several advantages over the WHOIS protocol, including support for internationalization, secure access to data, and the ability to provide differentiated access to registration data. Here is the RDAP raw data for 5ybq.com.

Summary

Registration Date2022-08-21
Expiration Date2023-08-21
Last Changed Date2022-11-25
Abuse Tel+39.05520021555
Abuse EMAIL[email protected]

Raw data

1{
2        "objectClassName": "domain",
3        "handle": "2719676311_DOMAIN_COM-VRSN",
4        "ldhName": "5YBQ.COM",
5        "links": [
6                {
7                        "value": "https://rdap.verisign.com/com/v1/domain/5YBQ.COM",
8                        "rel": "self",
9                        "href": "https://rdap.verisign.com/com/v1/domain/5YBQ.COM",
10                        "type": "application/rdap+json"
11                },
12                {
13                        "value": "https://rdap-register.info/domain/5YBQ.COM",
14                        "rel": "related",
15                        "href": "https://rdap-register.info/domain/5YBQ.COM",
16                        "type": "application/rdap+json"
17                }
18        ],
19        "status": [
20                "active"
21        ],
22        "entities": [
23                {
24                        "objectClassName": "entity",
25                        "handle": "168",
26                        "roles": [
27                                "registrar"
28                        ],
29                        "publicIds": [
30                                {
31                                        "type": "IANA Registrar ID",
32                                        "identifier": "168"
33                                }
34                        ],
35                        "vcardArray": [
36                                "vcard",
37                                [
38                                        [
39                                                "version",
40                                                {},
41                                                "text",
42                                                "4.0"
43                                        ],
44                                        [
45                                                "fn",
46                                                {},
47                                                "text",
48                                                "Register SPA"
49                                        ]
50                                ]
51                        ],
52                        "entities": [
53                                {
54                                        "objectClassName": "entity",
55                                        "roles": [
56                                                "abuse"
57                                        ],
58                                        "vcardArray": [
59                                                "vcard",
60                                                [
61                                                        [
62                                                                "version",
63                                                                {},
64                                                                "text",
65                                                                "4.0"
66                                                        ],
67                                                        [
68                                                                "fn",
69                                                                {},
70                                                                "text",
71                                                                ""
72                                                        ],
73                                                        [
74                                                                "tel",
75                                                                {
76                                                                        "type": "voice"
77                                                                },
78                                                                "uri",
79                                                                "tel:+39.05520021555"
80                                                        ],
81                                                        [
82                                                                "email",
83                                                                {},
84                                                                "text",
85                                                                "[email protected]"
86                                                        ]
87                                                ]
88                                        ]
89                                }
90                        ]
91                }
92        ],
93        "events": [
94                {
95                        "eventAction": "registration",
96                        "eventDate": "2022-08-21T06:58:10Z"
97                },
98                {
99                        "eventAction": "expiration",
100                        "eventDate": "2023-08-21T06:58:10Z"
101                },
102                {
103                        "eventAction": "last changed",
104                        "eventDate": "2022-11-25T21:17:15Z"
105                },
106                {
107                        "eventAction": "last update of RDAP database",
108                        "eventDate": "2023-06-29T07:12:53Z"
109                }
110        ],
111        "secureDNS": {
112                "delegationSigned": false
113        },
114        "nameservers": [
115                {
116                        "objectClassName": "nameserver",
117                        "ldhName": "ASPEN.NS.CLOUDFLARE.COM"
118                },
119                {
120                        "objectClassName": "nameserver",
121                        "ldhName": "GABRIEL.NS.CLOUDFLARE.COM"
122                }
123        ],
124        "rdapConformance": [
125                "rdap_level_0",
126                "icann_rdap_technical_implementation_guide_0",
127                "icann_rdap_response_profile_0"
128        ],
129        "notices": [
130                {
131                        "title": "Terms of Use",
132                        "description": [
133                                "Service subject to Terms of Use."
134                        ],
135                        "links": [
136                                {
137                                        "href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
138                                        "type": "text/html"
139                                }
140                        ]
141                },
142                {
143                        "title": "Status Codes",
144                        "description": [
145                                "For more information on domain status codes, please visit https://icann.org/epp"
146                        ],
147                        "links": [
148                                {
149                                        "href": "https://icann.org/epp",
150                                        "type": "text/html"
151                                }
152                        ]
153                },
154                {
155                        "title": "RDDS Inaccuracy Complaint Form",
156                        "description": [
157                                "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
158                        ],
159                        "links": [
160                                {
161                                        "href": "https://icann.org/wicf",
162                                        "type": "text/html"
163                                }
164                        ]
165                }
166        ]
167}

Free Tools

Free IP Address Lookup Tool

Enter an IP address to obtain detailed information about it, including geographical location, supplier, ASN, and Whois information.Track and locate IP addresses

Website Alternative Finder

Examine the websites and provide a selection of alternative options.

What is My IP

All information about your IP address. Location, timezone, network, address type (IPv4 or IPv6) and more. See your real public IP.

FAQ

What ip addresses 5ybq.com is hosted on?

There are 2 IP address hosting 5ybq.com. 104.21.57.68, 172.67.189.99

When was 5ybq.com registered?

5ybq.com registered in 2022-08-21.

When does the 5ybq.com expire?

5ybq.com expires in 2023-08-21.