ASN | AS13335 - CLOUDFLARENET |
Range | 172.64.0.0/14 |
Company | CloudFlare Inc. |
Registration Date | 2015-02-26 |
Last Changed Date | 2021-05-26 |
Abuse Email | [email protected] |
Abuse Tel | +1-650-319-8930 |
Hosted domains | 24 |
Hosted Mail Servers | 0 |
Hosted Name Servers | 0 |
IP location is used to determine the physical location (such as country, region, city, and latitude/longitude coordinates) of the device associated with a specific IP address.The IP address 172.67.189.99 is located in United States of America
City | San Francisco |
Country | United States of America |
Postal | 94107 |
Timezone | -07:00 |
Coordinates | 37.7757 , -122.3952 |
Showing the list of domain hosted on IP Address 172.67.189.99
DOMAIN | Global Rank | Category | Title | A | MX | NS |
---|---|---|---|---|---|---|
stotaidisurvey.top | 996,146 | - | index | - |
| |
seascapevacationhomes.com | 2,435,506 | Sea Scape Properties - Property Management & Vacation Rentals |
|
| ||
zauers.lv | 2,436,156 | E-commerce And Shopping | - |
|
| |
oxide.systems | 7,477,733 | - | - |
|
| |
speakenglishwithtiffaniacademy.com | - | - | LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy |
|
| |
covemavernici.com | - | - | - |
|
| |
67prostitutka.ru | - | - | - | - |
| |
telek.top | - | - | Telek.top: Смотреть ТВ онлайн. Бесплатный прямой эфир российских телеканалов. | - |
| |
vulkandeluxe-zx8.top | - | - | - | - |
| |
malatyastyla.com | - | - | - | - |
| |
nova88bets.bet | - | - | - | - |
| |
5ybq.com | - | - | - |
|
| |
cashforhome.com | - | - | We Buy Houses in South Carolina - Sell My House Fast for Cash |
|
| |
tiranetwork.com | - | - | - |
|
| |
mfkmh.xyz | - | - | - | - |
| |
oldstatehouse.com | - | - | - |
|
| |
asianxhamster.name | - | - | Asian Xhamster - Top Destination For Online Asian Porn Gems | - |
| |
adsmark.net | - | - | Ads Market |
|
| |
kanxi123.net | - | - | - | - |
| |
seenunseen.in | - | - | The Seen and the Unseen - a podcast by Amit Varma |
|
| |
schumanclean.com | - | - | Schuman Cleaning |
|
| |
fsgangweishi.com | - | - | 91porn|91PORNF|国产自拍|成人视频|蝌蚪视频|91视频|91自拍 | - |
| |
haberufku.com | - | - | - |
|
| |
ingyenporno.cyou | - | - | - | - |
|
Showing the number of hosted domain, name server and mail server of IP address around 172.67.189.99
RDAP stands for Registration Data Access Protocol. It is a protocol used to access and retrieve registration data for internet resources such as domain names, IP addresses, and autonomous system numbers. RDAP has several advantages over the WHOIS protocol, including support for internationalization, secure access to data, and the ability to provide differentiated access to registration data. Here is the RDAP raw data for 172.67.189.99.
Name | CLOUDFLARENET |
Registration Date | 2015-02-26 |
Last Changed Date | 2021-05-26 |
Routing Tel | +1-650-319-8930 |
Routing EMAIL | [email protected] |
Abuse Tel | +1-650-319-8930 |
Abuse EMAIL | [email protected] |
Administrative Tel | +1-650-319-8930 |
Technical Tel | +1-650-319-8930 |
Administrative EMAIL | [email protected] |
Technical EMAIL | [email protected] |
1{
2 "rdapConformance": [
3 "nro_rdap_profile_0",
4 "rdap_level_0",
5 "cidr0",
6 "arin_originas0"
7 ],
8 "notices": [
9 {
10 "title": "Terms of Service",
11 "description": [
12 "By using the ARIN RDAP/Whois service, you are agreeing to the RDAP/Whois Terms of Use"
13 ],
14 "links": [
15 {
16 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
17 "rel": "terms-of-service",
18 "type": "text/html",
19 "href": "https://www.arin.net/resources/registry/whois/tou/"
20 }
21 ]
22 },
23 {
24 "title": "Whois Inaccuracy Reporting",
25 "description": [
26 "If you see inaccuracies in the results, please visit: "
27 ],
28 "links": [
29 {
30 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
31 "rel": "inaccuracy-report",
32 "type": "text/html",
33 "href": "https://www.arin.net/resources/registry/whois/inaccuracy_reporting/"
34 }
35 ]
36 },
37 {
38 "title": "Copyright Notice",
39 "description": [
40 "Copyright 1997-2023, American Registry for Internet Numbers, Ltd."
41 ]
42 }
43 ],
44 "handle": "NET-172-64-0-0-1",
45 "startAddress": "172.64.0.0",
46 "endAddress": "172.71.255.255",
47 "ipVersion": "v4",
48 "name": "CLOUDFLARENET",
49 "type": "DIRECT ALLOCATION",
50 "parentHandle": "NET-172-0-0-0-0",
51 "remarks": [
52 {
53 "title": "Registration Comments",
54 "description": [
55 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
56 ]
57 }
58 ],
59 "events": [
60 {
61 "eventAction": "last changed",
62 "eventDate": "2021-05-26T18:01:44-04:00"
63 },
64 {
65 "eventAction": "registration",
66 "eventDate": "2015-02-25T20:57:09-05:00"
67 }
68 ],
69 "links": [
70 {
71 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
72 "rel": "self",
73 "type": "application/rdap+json",
74 "href": "https://rdap.arin.net/registry/ip/172.64.0.0"
75 },
76 {
77 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
78 "rel": "alternate",
79 "type": "application/xml",
80 "href": "https://whois.arin.net/rest/net/NET-172-64-0-0-1"
81 }
82 ],
83 "entities": [
84 {
85 "handle": "CLOUD14",
86 "vcardArray": [
87 "vcard",
88 [
89 [
90 "version",
91 {},
92 "text",
93 "4.0"
94 ],
95 [
96 "fn",
97 {},
98 "text",
99 "Cloudflare, Inc."
100 ],
101 [
102 "adr",
103 {
104 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
105 },
106 "text",
107 [
108 "",
109 "",
110 "",
111 "",
112 "",
113 "",
114 ""
115 ]
116 ],
117 [
118 "kind",
119 {},
120 "text",
121 "org"
122 ]
123 ]
124 ],
125 "roles": [
126 "registrant"
127 ],
128 "links": [
129 {
130 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
131 "rel": "self",
132 "type": "application/rdap+json",
133 "href": "https://rdap.arin.net/registry/entity/CLOUD14"
134 },
135 {
136 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
137 "rel": "alternate",
138 "type": "application/xml",
139 "href": "https://whois.arin.net/rest/org/CLOUD14"
140 }
141 ],
142 "events": [
143 {
144 "eventAction": "last changed",
145 "eventDate": "2021-07-01T14:16:19-04:00"
146 },
147 {
148 "eventAction": "registration",
149 "eventDate": "2010-07-09T14:10:42-04:00"
150 }
151 ],
152 "entities": [
153 {
154 "handle": "CLOUD146-ARIN",
155 "vcardArray": [
156 "vcard",
157 [
158 [
159 "version",
160 {},
161 "text",
162 "4.0"
163 ],
164 [
165 "adr",
166 {
167 "label": "101 Townsend St\nSan Francsico\nCA\n94107\nUnited States"
168 },
169 "text",
170 [
171 "",
172 "",
173 "",
174 "",
175 "",
176 "",
177 ""
178 ]
179 ],
180 [
181 "fn",
182 {},
183 "text",
184 "Cloudflare-NOC"
185 ],
186 [
187 "org",
188 {},
189 "text",
190 "Cloudflare-NOC"
191 ],
192 [
193 "kind",
194 {},
195 "text",
196 "group"
197 ],
198 [
199 "email",
200 {},
201 "text",
202 "[email protected]"
203 ],
204 [
205 "tel",
206 {
207 "type": [
208 "work",
209 "voice"
210 ]
211 },
212 "text",
213 "+1-650-319-8930"
214 ]
215 ]
216 ],
217 "roles": [
218 "routing",
219 "noc"
220 ],
221 "links": [
222 {
223 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
224 "rel": "self",
225 "type": "application/rdap+json",
226 "href": "https://rdap.arin.net/registry/entity/CLOUD146-ARIN"
227 },
228 {
229 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
230 "rel": "alternate",
231 "type": "application/xml",
232 "href": "https://whois.arin.net/rest/poc/CLOUD146-ARIN"
233 }
234 ],
235 "events": [
236 {
237 "eventAction": "last changed",
238 "eventDate": "2022-08-09T13:36:09-04:00"
239 },
240 {
241 "eventAction": "registration",
242 "eventDate": "2021-07-01T14:10:58-04:00"
243 }
244 ],
245 "status": [
246 "validated"
247 ],
248 "port43": "whois.arin.net",
249 "objectClassName": "entity"
250 },
251 {
252 "handle": "ABUSE2916-ARIN",
253 "vcardArray": [
254 "vcard",
255 [
256 [
257 "version",
258 {},
259 "text",
260 "4.0"
261 ],
262 [
263 "adr",
264 {
265 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
266 },
267 "text",
268 [
269 "",
270 "",
271 "",
272 "",
273 "",
274 "",
275 ""
276 ]
277 ],
278 [
279 "fn",
280 {},
281 "text",
282 "Abuse"
283 ],
284 [
285 "org",
286 {},
287 "text",
288 "Abuse"
289 ],
290 [
291 "kind",
292 {},
293 "text",
294 "group"
295 ],
296 [
297 "email",
298 {},
299 "text",
300 "[email protected]"
301 ],
302 [
303 "tel",
304 {
305 "type": [
306 "work",
307 "voice"
308 ]
309 },
310 "text",
311 "+1-650-319-8930"
312 ]
313 ]
314 ],
315 "roles": [
316 "abuse"
317 ],
318 "remarks": [
319 {
320 "title": "Registration Comments",
321 "description": [
322 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
323 ]
324 },
325 {
326 "title": "Unvalidated POC",
327 "description": [
328 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
329 ]
330 }
331 ],
332 "links": [
333 {
334 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
335 "rel": "self",
336 "type": "application/rdap+json",
337 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
338 },
339 {
340 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
341 "rel": "alternate",
342 "type": "application/xml",
343 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
344 }
345 ],
346 "events": [
347 {
348 "eventAction": "last changed",
349 "eventDate": "2020-04-23T11:06:59-04:00"
350 },
351 {
352 "eventAction": "registration",
353 "eventDate": "2011-02-14T19:00:47-05:00"
354 }
355 ],
356 "port43": "whois.arin.net",
357 "objectClassName": "entity"
358 },
359 {
360 "handle": "ADMIN2521-ARIN",
361 "vcardArray": [
362 "vcard",
363 [
364 [
365 "version",
366 {},
367 "text",
368 "4.0"
369 ],
370 [
371 "adr",
372 {
373 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
374 },
375 "text",
376 [
377 "",
378 "",
379 "",
380 "",
381 "",
382 "",
383 ""
384 ]
385 ],
386 [
387 "fn",
388 {},
389 "text",
390 "Admin"
391 ],
392 [
393 "org",
394 {},
395 "text",
396 "Admin"
397 ],
398 [
399 "kind",
400 {},
401 "text",
402 "group"
403 ],
404 [
405 "email",
406 {},
407 "text",
408 "[email protected]"
409 ],
410 [
411 "tel",
412 {
413 "type": [
414 "work",
415 "voice"
416 ]
417 },
418 "text",
419 "+1-650-319-8930"
420 ]
421 ]
422 ],
423 "roles": [
424 "administrative",
425 "technical"
426 ],
427 "remarks": [
428 {
429 "title": "Registration Comments",
430 "description": [
431 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
432 ]
433 }
434 ],
435 "links": [
436 {
437 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
438 "rel": "self",
439 "type": "application/rdap+json",
440 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
441 },
442 {
443 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
444 "rel": "alternate",
445 "type": "application/xml",
446 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
447 }
448 ],
449 "events": [
450 {
451 "eventAction": "last changed",
452 "eventDate": "2023-01-31T08:56:46-05:00"
453 },
454 {
455 "eventAction": "registration",
456 "eventDate": "2011-04-19T16:11:36-04:00"
457 }
458 ],
459 "status": [
460 "validated"
461 ],
462 "port43": "whois.arin.net",
463 "objectClassName": "entity"
464 }
465 ],
466 "port43": "whois.arin.net",
467 "objectClassName": "entity"
468 },
469 {
470 "handle": "ABUSE2916-ARIN",
471 "vcardArray": [
472 "vcard",
473 [
474 [
475 "version",
476 {},
477 "text",
478 "4.0"
479 ],
480 [
481 "adr",
482 {
483 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
484 },
485 "text",
486 [
487 "",
488 "",
489 "",
490 "",
491 "",
492 "",
493 ""
494 ]
495 ],
496 [
497 "fn",
498 {},
499 "text",
500 "Abuse"
501 ],
502 [
503 "org",
504 {},
505 "text",
506 "Abuse"
507 ],
508 [
509 "kind",
510 {},
511 "text",
512 "group"
513 ],
514 [
515 "email",
516 {},
517 "text",
518 "[email protected]"
519 ],
520 [
521 "tel",
522 {
523 "type": [
524 "work",
525 "voice"
526 ]
527 },
528 "text",
529 "+1-650-319-8930"
530 ]
531 ]
532 ],
533 "roles": [
534 "abuse"
535 ],
536 "remarks": [
537 {
538 "title": "Registration Comments",
539 "description": [
540 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
541 ]
542 },
543 {
544 "title": "Unvalidated POC",
545 "description": [
546 "ARIN has attempted to validate the data for this POC, but has received no response from the POC since 2021-04-23"
547 ]
548 }
549 ],
550 "links": [
551 {
552 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
553 "rel": "self",
554 "type": "application/rdap+json",
555 "href": "https://rdap.arin.net/registry/entity/ABUSE2916-ARIN"
556 },
557 {
558 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
559 "rel": "alternate",
560 "type": "application/xml",
561 "href": "https://whois.arin.net/rest/poc/ABUSE2916-ARIN"
562 }
563 ],
564 "events": [
565 {
566 "eventAction": "last changed",
567 "eventDate": "2020-04-23T11:06:59-04:00"
568 },
569 {
570 "eventAction": "registration",
571 "eventDate": "2011-02-14T19:00:47-05:00"
572 }
573 ],
574 "port43": "whois.arin.net",
575 "objectClassName": "entity"
576 },
577 {
578 "handle": "ADMIN2521-ARIN",
579 "vcardArray": [
580 "vcard",
581 [
582 [
583 "version",
584 {},
585 "text",
586 "4.0"
587 ],
588 [
589 "adr",
590 {
591 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
592 },
593 "text",
594 [
595 "",
596 "",
597 "",
598 "",
599 "",
600 "",
601 ""
602 ]
603 ],
604 [
605 "fn",
606 {},
607 "text",
608 "Admin"
609 ],
610 [
611 "org",
612 {},
613 "text",
614 "Admin"
615 ],
616 [
617 "kind",
618 {},
619 "text",
620 "group"
621 ],
622 [
623 "email",
624 {},
625 "text",
626 "[email protected]"
627 ],
628 [
629 "tel",
630 {
631 "type": [
632 "work",
633 "voice"
634 ]
635 },
636 "text",
637 "+1-650-319-8930"
638 ]
639 ]
640 ],
641 "roles": [
642 "technical"
643 ],
644 "remarks": [
645 {
646 "title": "Registration Comments",
647 "description": [
648 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
649 ]
650 }
651 ],
652 "links": [
653 {
654 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
655 "rel": "self",
656 "type": "application/rdap+json",
657 "href": "https://rdap.arin.net/registry/entity/ADMIN2521-ARIN"
658 },
659 {
660 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
661 "rel": "alternate",
662 "type": "application/xml",
663 "href": "https://whois.arin.net/rest/poc/ADMIN2521-ARIN"
664 }
665 ],
666 "events": [
667 {
668 "eventAction": "last changed",
669 "eventDate": "2023-01-31T08:56:46-05:00"
670 },
671 {
672 "eventAction": "registration",
673 "eventDate": "2011-04-19T16:11:36-04:00"
674 }
675 ],
676 "status": [
677 "validated"
678 ],
679 "port43": "whois.arin.net",
680 "objectClassName": "entity"
681 },
682 {
683 "handle": "NOC11962-ARIN",
684 "vcardArray": [
685 "vcard",
686 [
687 [
688 "version",
689 {},
690 "text",
691 "4.0"
692 ],
693 [
694 "adr",
695 {
696 "label": "101 Townsend Street\nSan Francisco\nCA\n94107\nUnited States"
697 },
698 "text",
699 [
700 "",
701 "",
702 "",
703 "",
704 "",
705 "",
706 ""
707 ]
708 ],
709 [
710 "fn",
711 {},
712 "text",
713 "NOC"
714 ],
715 [
716 "org",
717 {},
718 "text",
719 "NOC"
720 ],
721 [
722 "kind",
723 {},
724 "text",
725 "group"
726 ],
727 [
728 "email",
729 {},
730 "text",
731 "[email protected]"
732 ],
733 [
734 "tel",
735 {
736 "type": [
737 "work",
738 "voice"
739 ]
740 },
741 "text",
742 "+1-650-319-8930"
743 ]
744 ]
745 ],
746 "roles": [
747 "noc"
748 ],
749 "remarks": [
750 {
751 "title": "Registration Comments",
752 "description": [
753 "All Cloudflare abuse reporting can be done via https://www.cloudflare.com/abuse"
754 ]
755 }
756 ],
757 "links": [
758 {
759 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
760 "rel": "self",
761 "type": "application/rdap+json",
762 "href": "https://rdap.arin.net/registry/entity/NOC11962-ARIN"
763 },
764 {
765 "value": "https://rdap.arin.net/registry/ip/172.66.0.1",
766 "rel": "alternate",
767 "type": "application/xml",
768 "href": "https://whois.arin.net/rest/poc/NOC11962-ARIN"
769 }
770 ],
771 "events": [
772 {
773 "eventAction": "last changed",
774 "eventDate": "2022-11-14T00:35:28-05:00"
775 },
776 {
777 "eventAction": "registration",
778 "eventDate": "2011-04-19T16:25:31-04:00"
779 }
780 ],
781 "status": [
782 "validated"
783 ],
784 "port43": "whois.arin.net",
785 "objectClassName": "entity"
786 }
787 ],
788 "port43": "whois.arin.net",
789 "status": [
790 "active"
791 ],
792 "objectClassName": "ip network",
793 "cidr0_cidrs": [
794 {
795 "v4prefix": "172.64.0.0",
796 "length": 13
797 }
798 ],
799 "arin_originas0_originautnums": [
800 13335
801 ]
802}
The ASN of 172.67.189.99 is 13335, AS Name is CloudFlare Inc.
24 domains hosted on 172.67.189.99
The country of 172.67.189.99 is United States of America, and it's city is San Francisco. The postal of 172.67.189.99 is 94107