Смотреть телеканалы онлайн. Прямой эфир ТВ в хорошем качестве. Архив телепрограмм. Смотрите без регистрации. Бесплатно.
| TLD | top |
View domain system records, including but not limited to the A, CNAME, MX, and TXT records.
| NS Record | IP |
|---|---|
| lily.ns.cloudflare.com | |
| seth.ns.cloudflare.com |
CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as telek.top has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.
A Nameserver Group consists of two or more nameservers, often provided by the web hosting company or domain registrar. Having multiple nameservers adds redundancy and improves the reliability of DNS resolution. Here are the domains using the following nameservers are the same as telek.top: lily.ns.cloudflare.com, seth.ns.cloudflare.com.
| DOMAIN | Global Rank | Category | Title | A | MX |
|---|---|---|---|---|---|
| nordpass.com | 41,624 | Computers Electronics And Technology | Securely Store, Manage & Autofill Passwords | NordPass |
| |
| pinbus.com | 46,401 | Travel And Tourism | Compra pasajes de Bus en Colombia | Pinbus.com |
| |
| debilizator.tv | 73,199 | - |
| ||
| bolde.com | 91,937 | - |
| ||
| nordvpn.net | 112,673 | Computers Electronics And Technology | - | - | |
| zwyr157wwiu6eior.com | 121,655 | - |
| ||
| nordlocker.com | 133,336 | Secure your files in a private file vault | NordLocker |
| ||
| gamak.tv | 142,045 | Запись эфира российских телевизионных каналов |
| ||
| ncheckout.com | 196,986 | Get Nord Security | Nord Checkout | - | ||
| growgrow.ge | 236,154 | Gambling | GrowGrow - კანაფის თესლების მაღაზია |
| |
| nordforme.org | 280,752 | The best online VPN service for speed and security | NordVPN |
| ||
| boi9osyg1uwtyafn.com | 300,275 | Computers Electronics And Technology | - | - | |
| nordauth.com | 325,062 | Computers Electronics And Technology | - | - | |
| cnwangluo.net | 388,281 | The best online VPN service for speed and security | NordVPN |
| ||
| nordsecurity.com | 509,780 | Computers Electronics And Technology | Digital security and privacy for everyone - Nord Security |
| |
| nordsec.com | 699,459 | - |
| ||
| icpsuawn1zy5amys.com | 814,542 | - | - | ||
| x9fnzrtl4x8pynsf.com | 817,984 | - | - | ||
| nord-help.com | 1,024,475 | Computers Electronics And Technology | The best online VPN service for speed and security | NordVPN |
| |
| 73dkt-vwrqs.xyz | 1,107,772 | - | - | ||
| nordcdn.com | 1,227,585 | Computers Electronics And Technology | - | - |
|
| se3v5tjfff3aet.me | 1,427,636 | Computers Electronics And Technology | - | - | |
| npass.app | 1,495,514 | - | - | - | - |
| nordforme.net | 1,518,806 | The best online VPN service for speed and security | NordVPN |
|
WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of telek.top. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.
Your access is too fast,please try again later.
There are 2 IP address hosting telek.top. 172.67.189.99, 104.21.57.68