TLD | cyou |
Domain Created Date | 2022-10-18 |
Domain Expiry Date | 2023-10-18 |
Domain Updated Date | 2022-11-16 |
Registrar Abuse Contact Email | [email protected] |
Registrar Abuse Contact Phone | +1.9854014545 |
View domain system records, including but not limited to the A, CNAME, MX, and TXT records.
NS Record | IP |
---|---|
buck.ns.cloudflare.com | |
penny.ns.cloudflare.com |
CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as ingyenporno.cyou has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.
A Nameserver Group consists of two or more nameservers, often provided by the web hosting company or domain registrar. Having multiple nameservers adds redundancy and improves the reliability of DNS resolution. Here are the domains using the following nameservers are the same as ingyenporno.cyou: buck.ns.cloudflare.com, penny.ns.cloudflare.com.
DOMAIN | Global Rank | Category | Title | A | MX |
---|---|---|---|---|---|
minibee.co.uk | 17,035,712 | - | Baby Clothing Store | Nursery Décor | Kids Accessories | Mini Bee |
| |
kinemotor.ru | - | - | Kinemotor |
| |
clubseacret.com | - | - | Club Seacret – Club Seacret |
|
Backlink is a hyperlink that points from one website to another. Backlinks are an essential aspect of Search Engine Optimization (SEO) because search engines like Google consider them as a vote of confidence or credibility for the linked website. Here are the list of ingyenporno.cyou backlinks.
WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of ingyenporno.cyou. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.
Domain Updated Date | 2022-11-16 |
Domain Created Date | 2022-10-18 |
Domain Expiry Date | 2023-10-18 |
Domain Name | INGYENPORNO.CYOU |
Registrar WHOIS Server | whois.namecheap.com |
Registrant Organization | Privacy service provided by Withheld for Privacy ehf |
Registrant State/Province | Capital Region |
Registrant Country | IS |
Registrant Email | Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. |
Registrar Abuse Contact Email | [email protected] |
Registrar Abuse Contact Phone | +1.9854014545 |
Domain Name: INGYENPORNO.CYOU Registry Domain ID: D328653574-CNIC Registrar WHOIS Server: whois.namecheap.com Registrar URL: https://namecheap.com Updated Date: 2022-11-16T09:53:43.0Z Creation Date: 2022-10-18T08:22:34.0Z Registry Expiry Date: 2023-10-18T23:59:59.0Z Registrar: Namecheap Registrar IANA ID: 1068 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registrant Organization: Privacy service provided by Withheld for Privacy ehf Registrant State/Province: Capital Region Registrant Country: IS Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Name Server: BUCK.NS.CLOUDFLARE.COM Name Server: PENNY.NS.CLOUDFLARE.COM DNSSEC: unsigned Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name. Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.9854014545 URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-07-02T09:30:31.0Z <<< For more information on Whois status codes, please visit https://icann.org/epp >>> IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit https://www.centralnic.com/support/rdap <<< The Whois and RDAP services are provided by CentralNic, and contain information pertaining to Internet domain names registered by our our customers. By using this service you are agreeing (1) not to use any information presented here for any purpose other than determining ownership of domain names, (2) not to store or reproduce this data in any way, (3) not to use any high-volume, automated, electronic processes to obtain data from this service. Abuse of this service is monitored and actions in contravention of these terms will result in being permanently blacklisted. All data is (c) CentralNic Ltd (https://www.centralnic.com) Access to the Whois and RDAP services is rate limited. For more information, visit https://registrar-console.centralnic.com/pub/whois_guidance.
There are 2 IP address hosting ingyenporno.cyou. 104.21.57.68, 172.67.189.99