| TLD | ru |
| Domain Created Date | 2022-10-16 |
| Domain Expiry Date | 2023-10-16 |
View domain system records, including but not limited to the A, CNAME, MX, and TXT records.
| NS Record | IP |
|---|---|
| clay.ns.cloudflare.com | |
| chan.ns.cloudflare.com |
CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as 67prostitutka.ru has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.
A Nameserver Group consists of two or more nameservers, often provided by the web hosting company or domain registrar. Having multiple nameservers adds redundancy and improves the reliability of DNS resolution. Here are the domains using the following nameservers are the same as 67prostitutka.ru: chan.ns.cloudflare.com, clay.ns.cloudflare.com.
| DOMAIN | Global Rank | Category | Title | A | MX |
|---|---|---|---|---|---|
| rezhimraboty.ru | 823,160 | Law And Government | Режим работы | - | |
| drink-mixer.com | 966,691 | Food And Drink | Самая полная база напитков и коктейлей от знатных алко-энтузиастов | - | |
| russ-boys.ru | 1,399,181 | - | Мальчики - Россия, парни по вызову, мальчики по вызову - boys-russ.ru | - | |
| asekol.cz | 2,135,519 | - |
| ||
| bitcoingold.org | 3,510,141 | Finance | Bitcoin Gold | Make Bitcoin decentralized again |
| |
| prostitutki12.ru | 3,602,607 | - | - | - | |
| find-open.ru | 3,904,555 | Режим работы организаций | - | ||
| kak-rabotaem.ru | 4,333,659 | News And Media | КакРаботаем.ру : часы работы, режимы работы, время работы организаций, фирм, государственных органов - commdesc | - | |
| kamchatka-girls.ru | 5,011,823 | - | - | - | |
| devka-vostok.ru | 5,115,191 | - | - | - | |
| kak-rabota.ru | 6,322,884 | Law And Government | Режим работы | - | |
| russmalchiki.ru | 7,256,937 | - | Мальчики - Россия, парни по вызову, мальчики по вызову - russmalchiki.com | - | |
| doskasex.ru | 10,099,729 | - | - | - | |
| prostitutka70.ru | 10,926,635 | - | - | - | |
| kolomna-prostitutka.ru | 11,778,320 | - | Welcome! | - | |
| prostitutka-38.ru | 11,881,182 | - | - | - | |
| sibirio.ru | 12,026,621 | - | Дон Сибирио – Все красивые массажистки Сибири | - | |
| intim-staryi-oskol.ru | 13,801,043 | - | - | - | |
| don-bishkek.com | 15,191,672 | - | Дон Бишкек – Боди массаж Бишкека | - | |
| individualka-cherepovets.ru | 18,400,786 | - | Welcome! | - | |
| russmalchik.ru | 19,142,716 | - | Мальчики - Россия, парни по вызову, мальчики по вызову - boys-russ.ru | - | |
| kaluga-girls.ru | - | - | - | - | |
| rascenki.net | - | - | Расценки.нет в России - отзывы, цены, контакты | - | |
| xn----8sbemcsnxyhe4d.xn--p1ai | - | - | Прайс-лист в городе Москва - расценки, цены, прейскурант. | - |
WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of 67prostitutka.ru. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.
| Domain Created Date | 2022-10-16 |
| Domain Expiry Date | 2023-10-16 |
| Domain Name | 67PROSTITUTKA.RU |
% TCI Whois Service. Terms of use: % https://tcinet.ru/documents/whois_ru_rf.pdf (in Russian) % https://tcinet.ru/documents/whois_su.pdf (in Russian) domain: 67PROSTITUTKA.RU nserver: chan.ns.cloudflare.com. nserver: clay.ns.cloudflare.com. state: REGISTERED, DELEGATED, UNVERIFIED person: Private Person registrar: REGRU-RU admin-contact: http://www.reg.ru/whois/admin_contact created: 2022-10-16T05:30:20Z paid-till: 2023-10-16T05:30:20Z free-date: 2023-11-16 source: TCI Last updated on 2023-06-27T08:21:30Z
There are 2 IP address hosting 67prostitutka.ru. 104.21.57.68, 172.67.189.99