, Preču katalogs
TLD | lv |
Bounce Rate | 30.12% |
Page Per Visit | 2.06 |
Monthly Visits | 17.55K |
Time On Site | 189.28S |
View domain system records, including but not limited to the A, CNAME, MX, and TXT records.
NS Record | IP |
---|---|
stan.ns.cloudflare.com | |
edna.ns.cloudflare.com |
Exchange | Priority | IP |
---|---|---|
mx2.latnet.lv | 20 | |
mx.latnet.lv | 10 |
CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as zauers.lv has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.
A Nameserver Group consists of two or more nameservers, often provided by the web hosting company or domain registrar. Having multiple nameservers adds redundancy and improves the reliability of DNS resolution. Here are the domains using the following nameservers are the same as zauers.lv: edna.ns.cloudflare.com, stan.ns.cloudflare.com.
DOMAIN | Global Rank | Category | Title | A | MX |
---|---|---|---|---|---|
triviador.com | 233,422 | - |
| ||
telegram1.cyou | 790,502 | - | Join Telegram | - | |
avesco-rent.ee | 14,519,632 | - | Avesco Rent - Ehitusmasinate rent |
| |
ssrmovies.repair | - | - | - | - | |
golestanmedical.com | - | - | فروشگاه تجهیزات پزشکی گلستان | - | |
ssrmovies.singles | - | - | - | - | |
ssrmovies.gold | - | - | - | - | |
opinie-konsumenckie.pl | - | - | Strona główna | Opinie Konsumentów |
| |
honfoglalo.hu | - | - | - |
| |
washingtoninst.org | - | - | The Washington Institute for Faith, Vocation and Culture |
| |
triviador.net | - | - | - |
| |
1ssrmovies.com | - | - | - | - | |
ssrmovies.motorcycles | - | - | - | - |
WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of zauers.lv. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.
[Domain] Domain: zauers.lv Status: active [Holder] Type: Natural person Visit: https://www.nic.lv/whois/contact/zauers.lv to contact. [Tech] Type: Natural person Visit: https://www.nic.lv/whois/contact/zauers.lv to contact. [Nservers] Nserver: edna.ns.cloudflare.com Nserver: stan.ns.cloudflare.com [Whois] Updated: 2023-06-17T05:12:27.897064+00:00 [Disclaimer] % The WHOIS service is provided solely for informational purposes. % % It is permitted to use the WHOIS service only for technical or administrative % needs associated with the operation of the Internet or in order to contact % the domain name holder over legal problems. % % Requestor will not use information obtained using WHOIS: % * To allow, enable or in any other way to support sending of unsolicited mails (spam) % * for any kind of advertising % * to disrupt Internet stability and security % % It is not permitted to obtain (including copying) or re-use in any form or % by any means all or quantitatively or qualitatively significant part % of the WHOIS without NIC's express permission.
There are 2 IP address hosting zauers.lv. 104.21.57.68, 172.67.189.99