TLD | com |
Domain Created Date | 2017-04-28 |
Domain Expiry Date | 2024-04-28 |
Domain Updated Date | 2023-04-02 |
Registrar Abuse Contact Email | [email protected] |
Registrar Abuse Contact Phone | +1.7203101849 |
View domain system records, including but not limited to the A, CNAME, MX, and TXT records.
NS Record | IP |
---|---|
dana.ns.cloudflare.com | |
max.ns.cloudflare.com |
CoHosted refers to a situation where multiple domain names (websites) are using the same IP address to point to their respective web servers. They could be owned by different individuals or organizations and may serve entirely different purposes.The domains hosted on the same IP address as malatyastyla.com has zauers.lv, speakenglishwithtiffaniacademy.com, covemavernici.com, 67prostitutka.ru, oxide.systems.
A Nameserver Group consists of two or more nameservers, often provided by the web hosting company or domain registrar. Having multiple nameservers adds redundancy and improves the reliability of DNS resolution. Here are the domains using the following nameservers are the same as malatyastyla.com: dana.ns.cloudflare.com, max.ns.cloudflare.com.
DOMAIN | Global Rank | Category | Title | A | MX |
---|---|---|---|---|---|
bitmidi.com | 65,142 | Popular MIDIs — BitMidi | - | ||
hqdragon.com | 107,605 | - | - | ||
javphim.win | 150,787 | - | Phim Sex, Xem Phim Sex Hay Cập Nhật Mỗi Ngày | - | |
smoketower.com | 214,519 | Vaporizers, Bongar, Rullpapper, Grinder, Vattenpipor, Pipor, Digitalvåg, Tändare |
| ||
the-ambient.com | 255,509 | Computers Electronics And Technology | The Ambient - Create the perfect connected home with our device reviews, guides and how-tos |
| |
kelloggsnyc.com | 527,464 | Kelloggs NYC - Informasi Teknologi, dan Wisata | - | ||
javphe.info | 761,767 | - | Phim Sex, Xem Phim Sex Hay Được Cập Nhật Liên Tục | - | |
perved.org | 1,393,829 | Adult | - |
| |
telcoswitch.com | 1,742,996 | Cloud Communications Built for You | TelcoSwitch |
| ||
safefreepornsites.com | 2,022,490 | Adult | - |
| |
sexsot.pro | 3,630,844 | - | Phim Sex, Xem Phim Sex Hay Tuyển Chọn Cập Nhật Mỗi Ngày | - | |
printshop.hk | 3,952,193 | 印館 PrintShop - 一站式印刷及噴畫專門店 |
| ||
123print.com.hk | 7,596,195 | 環球印刷集團有限公司 |
| ||
uzaweb.com | 8,325,601 | Science And Education | บริษัท ทำเว็บไซต์ เขียนโปรแกรม PHP Python ดูแลเว็บไซต์ wordpress |
| |
pornfreesites.com | 9,478,612 | Adult | - |
| |
javphot.pro | 9,807,100 | - | Phim Sex XXX Mới, Xem Phim Sex JAV Hay Mới Nhất | - | |
sexsung.com | 10,317,572 | Adult | - | - | |
cdiabetes.com | 10,771,243 | CDiabetes.com - Cardio and Diabetes Healthy Living Tips: Save On Diabetes Products and Learn More About Managing Diabetes |
| ||
koonwahfood.com.hk | 20,355,004 | - | 冠華食品 |
| |
etn.com.mx | - | - | You are being redirected... |
| |
loopme.com | - | - | LoopMe | Closing the Loop on Digital Advertising |
| |
javphim.wtf | - | - | - | - | |
javgg.vip | - | - | - | - | |
xxngon.lol | - | - | Phim Sex Hay, HD Tốc Độ Nhanh Được Cập Nhật Mỗi Ngày | - |
Backlink is a hyperlink that points from one website to another. Backlinks are an essential aspect of Search Engine Optimization (SEO) because search engines like Google consider them as a vote of confidence or credibility for the linked website. Here are the list of malatyastyla.com backlinks.
WHOIS is a query and response protocol used to obtain information about domain names and IP addresses. It is commonly used to retrieve registration details and ownership information for a specific domain name or IP address on the internet. Explore the most important information includes the registration details and administrative contact information of malatyastyla.com. This includes the owner's name, organization, abuse email address, abuse phone number, and the creation and expiration dates.
Domain Updated Date | 2023-04-02 |
Domain Created Date | 2017-04-28 |
Domain Expiry Date | 2024-04-28 |
Domain Name | MALATYASTYLA.COM |
Registrar WHOIS Server | whois.name.com |
Registrant Organization | Domain Protection Services, Inc. |
Registrant Street | PO Box 1769 |
Registrant City | Denver |
Registrant State/Province | CO |
Registrant Postal Code | 80201 |
Registrant Country | US |
Registrant Phone | +1.7208009072 |
Registrant Fax | +1.7209758725 |
Registrant Email | https://www.name.com/contact-domain-whois/malatyastyla.com |
Registrar Abuse Contact Email | [email protected] |
Registrar Abuse Contact Phone | +1.7203101849 |
Domain Name: MALATYASTYLA.COM Registry Domain ID: 2118497123_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.name.com Registrar URL: http://www.name.com Updated Date: 2023-04-02T23:24:05Z Creation Date: 2017-04-28T17:00:42Z Registry Expiry Date: 2024-04-28T17:00:42Z Registrar: Name.com, Inc. Registrar IANA ID: 625 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: 7202492374 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DANA.NS.CLOUDFLARE.COM Name Server: MAX.NS.CLOUDFLARE.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2023-06-29T05:50:17Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.
Domain Name: MALATYASTYLA.COM Registry Domain ID: 2118497123_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.name.com Registrar URL: http://www.name.com Updated Date: 2023-04-02T23:24:05Z Creation Date: 2017-04-28T17:00:42Z Registrar Registration Expiration Date: 2024-04-28T17:00:42Z Registrar: Name.com, Inc. Registrar IANA ID: 625 Reseller: Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Redacted For Privacy Registrant Organization: Domain Protection Services, Inc. Registrant Street: PO Box 1769 Registrant City: Denver Registrant State/Province: CO Registrant Postal Code: 80201 Registrant Country: US Registrant Phone: +1.7208009072 Registrant Fax: +1.7209758725 Registrant Email: https://www.name.com/contact-domain-whois/malatyastyla.com Registry Admin ID: Not Available From Registry Admin Name: Redacted For Privacy Admin Organization: Domain Protection Services, Inc. Admin Street: PO Box 1769 Admin City: Denver Admin State/Province: CO Admin Postal Code: 80201 Admin Country: US Admin Phone: +1.7208009072 Admin Fax: +1.7209758725 Admin Email: https://www.name.com/contact-domain-whois/malatyastyla.com Registry Tech ID: Not Available From Registry Tech Name: Redacted For Privacy Tech Organization: Domain Protection Services, Inc. Tech Street: PO Box 1769 Tech City: Denver Tech State/Province: CO Tech Postal Code: 80201 Tech Country: US Tech Phone: +1.7208009072 Tech Fax: +1.7209758725 Tech Email: https://www.name.com/contact-domain-whois/malatyastyla.com Name Server: max.ns.cloudflare.com Name Server: dana.ns.cloudflare.com DNSSEC: unSigned Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.7203101849 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-29T05:50:31Z <<< For more information on Whois status codes, please visit https://icann.org/epp The data in the Name.com, Inc. WHOIS database is provided by Name.com, Inc. for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. Name.com, Inc. does not guarantee its accuracy. Users accessing the Name.com, Inc. WHOIS service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Name.com, Inc., except as reasonably necessary to register domain names or modify existing registrations. When using the Name.com, Inc. WHOIS service, please consider the following: the WHOIS service is not a replacement for standard EPP commands to the SRS service. WHOIS is not considered authoritative for registered domain objects. The WHOIS service may be scheduled for downtime during production or OT&E maintenance periods. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis, for accessing the withheld data. Access to this data can be requested by submitting a request via the form found at https://www.name.com/layered-access-request . Name.com, Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
RDAP stands for Registration Data Access Protocol. It is a protocol used to access and retrieve registration data for internet resources such as domain names, IP addresses, and autonomous system numbers. RDAP has several advantages over the WHOIS protocol, including support for internationalization, secure access to data, and the ability to provide differentiated access to registration data. Here is the RDAP raw data for malatyastyla.com.
Registration Date | 2017-04-28 |
Expiration Date | 2024-04-28 |
Last Changed Date | 2023-04-02 |
Abuse Tel | 7202492374 |
Abuse EMAIL | [email protected] |
1{
2 "objectClassName": "domain",
3 "handle": "2118497123_DOMAIN_COM-VRSN",
4 "ldhName": "MALATYASTYLA.COM",
5 "links": [
6 {
7 "value": "https://rdap.verisign.com/com/v1/domain/MALATYASTYLA.COM",
8 "rel": "self",
9 "href": "https://rdap.verisign.com/com/v1/domain/MALATYASTYLA.COM",
10 "type": "application/rdap+json"
11 },
12 {
13 "value": "https://namerdap.systems/domain/MALATYASTYLA.COM",
14 "rel": "related",
15 "href": "https://namerdap.systems/domain/MALATYASTYLA.COM",
16 "type": "application/rdap+json"
17 }
18 ],
19 "status": [
20 "client transfer prohibited"
21 ],
22 "entities": [
23 {
24 "objectClassName": "entity",
25 "handle": "625",
26 "roles": [
27 "registrar"
28 ],
29 "publicIds": [
30 {
31 "type": "IANA Registrar ID",
32 "identifier": "625"
33 }
34 ],
35 "vcardArray": [
36 "vcard",
37 [
38 [
39 "version",
40 {},
41 "text",
42 "4.0"
43 ],
44 [
45 "fn",
46 {},
47 "text",
48 "Name.com, Inc."
49 ]
50 ]
51 ],
52 "entities": [
53 {
54 "objectClassName": "entity",
55 "roles": [
56 "abuse"
57 ],
58 "vcardArray": [
59 "vcard",
60 [
61 [
62 "version",
63 {},
64 "text",
65 "4.0"
66 ],
67 [
68 "fn",
69 {},
70 "text",
71 ""
72 ],
73 [
74 "tel",
75 {
76 "type": "voice"
77 },
78 "uri",
79 "tel:7202492374"
80 ],
81 [
82 "email",
83 {},
84 "text",
85 "[email protected]"
86 ]
87 ]
88 ]
89 }
90 ]
91 }
92 ],
93 "events": [
94 {
95 "eventAction": "registration",
96 "eventDate": "2017-04-28T17:00:42Z"
97 },
98 {
99 "eventAction": "expiration",
100 "eventDate": "2024-04-28T17:00:42Z"
101 },
102 {
103 "eventAction": "last changed",
104 "eventDate": "2023-04-02T23:24:05Z"
105 },
106 {
107 "eventAction": "last update of RDAP database",
108 "eventDate": "2023-06-29T05:13:14Z"
109 }
110 ],
111 "secureDNS": {
112 "delegationSigned": false
113 },
114 "nameservers": [
115 {
116 "objectClassName": "nameserver",
117 "ldhName": "DANA.NS.CLOUDFLARE.COM"
118 },
119 {
120 "objectClassName": "nameserver",
121 "ldhName": "MAX.NS.CLOUDFLARE.COM"
122 }
123 ],
124 "rdapConformance": [
125 "rdap_level_0",
126 "icann_rdap_technical_implementation_guide_0",
127 "icann_rdap_response_profile_0"
128 ],
129 "notices": [
130 {
131 "title": "Terms of Use",
132 "description": [
133 "Service subject to Terms of Use."
134 ],
135 "links": [
136 {
137 "href": "https://www.verisign.com/domain-names/registration-data-access-protocol/terms-service/index.xhtml",
138 "type": "text/html"
139 }
140 ]
141 },
142 {
143 "title": "Status Codes",
144 "description": [
145 "For more information on domain status codes, please visit https://icann.org/epp"
146 ],
147 "links": [
148 {
149 "href": "https://icann.org/epp",
150 "type": "text/html"
151 }
152 ]
153 },
154 {
155 "title": "RDDS Inaccuracy Complaint Form",
156 "description": [
157 "URL of the ICANN RDDS Inaccuracy Complaint Form: https://icann.org/wicf"
158 ],
159 "links": [
160 {
161 "href": "https://icann.org/wicf",
162 "type": "text/html"
163 }
164 ]
165 }
166 ]
167}
There are 2 IP address hosting malatyastyla.com. 172.67.189.99, 104.21.57.68
malatyastyla.com registered in 2017-04-28.
malatyastyla.com expires in 2024-04-28.